KEGG   Alkaliphilus oremlandii: Clos_2044Help
Entry
Clos_2044         CDS       T00607                                 

Definition
NUDIX hydrolase
Orthology
K03574  
8-oxo-dGTP diphosphatase [EC:3.6.1.55]
Organism
aoe  Alkaliphilus oremlandii
Brite
Enzymes [BR:aoe01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.55  8-oxo-dGTP diphosphatase
     Clos_2044
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2175229..2175648)
Genome map
AA seq 139 aa AA seqDB search
MGLKKVTVVYCLLYNKETNEVLMVYNGDSSRWSLPGGAVESGETLEQAVVREVYEETNLS
VKVKQIACVNERFFQDKDEHVVFITFIGEIIGGNISINHPEEISEIIWVNIREADQLMPY
YQFNINNFIHNSVPYIFQE
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgggattgaaaaaagtaacggttgtgtattgtctattatataataaagagacgaatgaa
gtgcttatggtttacaatggtgattccagtagatggtctctgcctggtggtgcggtagag
tcaggtgaaaccttagagcaagctgttgtgagagaagtttatgaagaaacgaatctttct
gtaaaagttaaacagatagcttgtgtaaatgagcgattttttcaagataaagatgagcat
gttgtttttattacatttatcggggaaattattggaggaaatatctcaattaatcatccg
gaagaaatttcagaaatcatttgggtaaatattagggaagcggatcaattaatgccttat
tatcagttcaatatcaataactttattcataattctgttccatatatttttcaagagtga

DBGET integrated database retrieval system