KEGG   Alkaliphilus oremlandii: Clos_2326Help
Entry
Clos_2326         CDS       T00607                                 

Definition
(GenBank) Magnesium chelatase
  KO
K03404  magnesium chelatase subunit D [EC:6.6.1.1]
Organism
aoe  Alkaliphilus oremlandii
Pathway
aoe00860  Porphyrin and chlorophyll metabolism
aoe01100  Metabolic pathways
aoe01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aoe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Clos_2326
Enzymes [BR:aoe01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Clos_2326
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VWA_2 AAA_5 VWA Mg_chelatase MCM Sigma54_activat AAA_16 AAA VWA_CoxE AAA_3
Motif
Other DBs
NCBI-ProteinID: ABW19859
JGI: Clos2326
UniProt: A8MJ77
Position
complement(2496065..2497954)
Genome map
AA seq 629 aa AA seqDB search
MESYRCFPFAAVCGQERVKKALILNVINPNIGGVLISGEKGTAKSTLVRGLANIIGDRAV
INLPLNITEDRLVGSVDINKAIQYGRKELEEGILKKAHHQFLYIDEVNLLSAYIVNILLE
VASTGVNIIEREGISYQHDSKFSLIGSMNPEEGTLGSQFIDRFGLYVETKGEEDLNIRLE
IMKRRLAYEKNPEGFCKSWAVASKAVEMNIREATNLLNYVRITEADYQLASDIGKEGRCA
GHRAEIILIEAARAIAAFNKRTYITQEDMKEASFYVLPHRMREQVSIEEVIEKNKASDSL
AENRAEESHHQNHSGEIDSSADKPISNGDYDGDSEHGDSSAEGSVSSHTVEDIEAFGEDL
SMDMVWQSRFAVKGSGKRNKVKTDSKEGRYIRYRIPKGRPKDIAFDATFRIAACSQGGRN
REGLSLVIRSGDIREKVREKHTGATILFVVDASGSMGAKRRMGAVKGAVLSLLNDAYQKR
DNVGIIAFRKDGADTLLNITRSVDLAQKCLTNLPTGGKTPLASGLYKAYELLKIDRIKNA
DALQYIVLVSDGKGNVPLFSENAIEDAYHVGEKIRNENIKSMVLDTENGYIQLGFAKKLA
EKMDSAYIKMNHISSKEIEDNVKGFIRTV
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atggaatcttatagatgctttccttttgctgcagtttgcggccaagaaagagtaaaaaag
gcgttaattttaaatgtaatcaatcccaatatcggcggcgtgctcatcagtggagaaaag
ggaactgcaaaatccaccttagtgagaggacttgcaaatattataggggatcgagccgta
atcaacttgccactgaatataacggaggatcgactggtcggtagcgttgacatcaacaaa
gcgattcaatatggtagaaaagagctggaagaaggtattttaaaaaaggcacatcatcag
tttctatacatagatgaagtaaacctcttgagtgcttatattgtcaatatacttttagaa
gtagcgtccactggtgtcaatatcattgagagggaaggaatctcctatcagcatgattct
aaattcagcttaatcggttctatgaacccggaagaggggacattgggatctcagtttata
gacagatttggactttatgtagaaacaaagggagaagaagatttaaatattcggttggaa
attatgaaaagaagactggcctatgagaagaatccagaagggttttgcaagtcatgggca
gtagccagtaaagcagtagaaatgaatattcgagaagcaaccaacctattaaactatgtg
aggattacagaagctgattatcaactggcatcggatattggcaaggaaggtcgctgtgca
ggtcatagagctgagatcatccttatagaagctgccagagctattgcggctttcaataaa
agaacctacatcactcaggaggatatgaaagaggcttccttctatgtacttccccatcgc
atgagggaacaagtatccattgaagaggtcattgaaaaaaataaagcgtcggattcctta
gcagaaaatagggcggaagaaagtcatcatcagaatcattcgggtgaaatagacagcagt
gctgacaaacctatttctaatggggattatgatggagactcagagcatggggattcaagt
gctgaaggaagtgtttcctcccatacggtagaagatatcgaagcttttggagaggattta
tccatggatatggtatggcaaagtagatttgctgtaaaggggagtggaaagcgaaataag
gtaaagacggatagtaaggaaggcagatatataagatatagaattccaaagggcagacca
aaggatatcgcctttgatgccacctttagaatcgctgcttgtagccaggggggaagaaat
agagaaggactgtctttagtcattcggtcgggggatatcagagaaaaggtaagagaaaag
catacgggtgctaccatactcttcgtggtggatgcaagcggctctatgggggcaaaaaga
cggatgggtgctgtaaaaggagcggtgctttccttattaaatgatgcttatcagaagaga
gacaatgtagggattattgcctttagaaaggatggggcagataccctattaaatattaca
agaagtgtagatttagcacagaaatgtctgaccaatctgcctacaggagggaaaacgccc
ttggcttctggactgtataaagcctatgaactgttaaagatagatcggataaaaaatgcc
gatgccctccaatatattgttctagtttccgatggaaagggtaatgtgcctttattcagt
gagaatgccatagaagatgcttaccatgttggagaaaagattcgaaatgaaaatattaaa
agtatggtattagatacggaaaatggctatattcaattgggatttgcgaaaaaattagca
gaaaaaatggacagtgcttatataaaaatgaatcatatatcttcaaaagaaattgaggac
aatgtgaagggatttattcgaactgtgtag

DBGET integrated database retrieval system