KEGG   Alkaliphilus oremlandii: Clos_2387Help
Entry
Clos_2387         CDS       T00607                                 

Definition
acetaldehyde dehydrogenase
Orthology
K00132  
acetaldehyde dehydrogenase (acetylating) [EC:1.2.1.10]
Organism
aoe  Alkaliphilus oremlandii
Pathway
Pyruvate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:aoe00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Clos_2387
   00650 Butanoate metabolism
    Clos_2387
Enzymes [BR:aoe01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Clos_2387
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2564511..2566040)
Genome map
AA seq 509 aa AA seqDB search
MESFDKDLRSVQEARDLARLGKIATKQLADYTEEQINKILCNMVRVAKENAVSLAKMAVE
ETGFGKVEDKTYKNHMASVLLYEAIKDMKTIGVIKEDTEEQVIEIAEPMGLLMGIVPSTN
PTSTAIFKSMIAIKSRNGIVFSPHPSALKCTLKAVRLMHDAAVEAGAPENIIGSISIPTI
QATNELMKHDDIAMIIATGGPGMVKASYSAGKPALGVGAGNSPAYIERTANIQKAVSNII
ASKTFDYGTICASEQSIIVEECNREAVVAELKKQGGYFMTEAETKKVCNLLFKNGHTMNA
QFVGRSPQVIAEAAGITIPEGTKILIGEQQGVGPAYPLSYEKLTTVIGFYTVKDWHEACD
LSIALLQNGIGHTMSLHTEDREMVMKFAKKPAARILVNTGSAQGGTGASTGLMPSFTLGC
GTWGGSATSENVTPMHLVNIKRVAYGLKDCTTLASADASFNYPELNGSATVGCTTESTPS
FNKVNSDVLDQEKLMDLVNGLLKAMKGED
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
ttggaaagctttgataaagacctacgttctgtacaagaggcaagggaccttgctagattg
ggaaaaattgctacaaaacagcttgccgactatacagaagaacaaattaacaaaatttta
tgcaacatggttagagttgcaaaggaaaatgcggtttccttagcaaaaatggctgtagag
gaaactggatttggtaaggttgaagataagacctataagaaccatatggcttccgtattg
ctttatgaagccattaaggatatgaaaaccatcggtgtaatcaaagaagatactgaggag
caagtaatcgagattgctgaaccgatgggattgttaatggggattgtaccttcaacgaat
ccaacatctactgctatttttaaatcaatgattgcaattaaatcacgaaatggaattgtt
ttttctcctcatccatctgcattaaaatgtacattgaaagctgtaagattaatgcatgat
gcagcagtagaagcaggcgcacctgaaaacattatagggagcatttccataccgaccata
caagctacaaatgaattaatgaagcacgatgatattgccatgattattgctacaggtggt
cctggaatggtgaaggcatcctatagtgcaggtaagccagccctaggtgttggtgcagga
aactctccagcatatattgaaagaactgcaaatatccaaaaagcagtcagcaatattatc
gcaagtaagacatttgattacggtaccatctgtgcatctgagcagtccatcatcgtggaa
gaatgcaaccgtgaagcagtagtagctgagcttaagaagcaaggcggatactttatgaca
gaagcagagacaaaaaaggtttgcaatcttttattcaagaatggccatacaatgaacgct
cagttcgttggtagaagtcctcaggtgattgctgaagccgcaggaattacaattcctgaa
ggaacaaagatcctgattggagaacaacaaggtgttggaccagcttacccattatcttat
gaaaagctgacaacagtgattggattctatactgtgaaagattggcacgaagcttgtgac
cttagtatagcgcttctacaaaatgggatcggtcataccatgagtcttcacacagaagat
cgagaaatggtgatgaagtttgctaaaaaaccagccgcacgtatccttgtaaatacaggt
agcgcccaaggtggaactggagccagcacaggattgatgccttcctttaccttaggttgt
ggtacatggggtggtagtgcgacttctgaaaacgttacaccaatgcacttagttaatatc
aaaagggttgcctacggtttaaaagactgtacaacattagcttcagcagatgcttccttc
aactatccagaactaaatggctctgcaacagtaggatgcactacggagagtaccccttct
ttcaataaagtaaattcagatgttctagatcaagaaaaactgatggatttagtaaatggc
ttactaaaagcaatgaagggagaagactag

DBGET integrated database retrieval system