KEGG   Alkaliphilus oremlandii: Clos_2854Help
Entry
Clos_2854         CDS       T00607                                 

Definition
(GenBank) recombination protein RecR
  KO
K06187  
recombination protein RecR
Organism
aoe  Alkaliphilus oremlandii
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:aoe00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Clos_2854
DNA repair and recombination proteins [BR:aoe03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     Clos_2854
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Clos_2854
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(3101569..3102168)
Genome map
AA seq 199 aa AA seqDB search
MNYYSASISQLIEEFTKLPGIGRKTAQRLAFHVINMPIQDAHNLADAIVKAKENIKYCKV
CTNLTDQEVCNICSDERRDPLLICVVEDPRDVVAMERTKEFKGYYHVLHGAISPLEGIGP
EDIKIKELLVRLSAQSADEVIIATNPNIEGEATAMYLSKLLKPMGIKVSRIAHGIPVGGD
LEYADEVTLTKALEGRREI
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaactattattcggcatcaattagtcagctaattgaagagtttacaaagcttcctggt
attggaagaaagacggctcagagattagcctttcacgttatcaatatgcccatacaagat
gcacataatttagcggatgcaattgtaaaggctaaggaaaatataaaatactgcaaggtc
tgtaccaatcttacggaccaagaggtatgtaatatctgtagtgatgaaagaagagaccct
ttattaatctgcgttgtagaggatcctagagatgtagtggccatggaaagaacaaaggaa
tttaaaggatattaccatgtgcttcacggagccatctcgcctttagaaggcattggccca
gaggatattaaaataaaagagcttcttgtacgtttatctgctcagtccgcagatgaagtg
attattgccacgaatcccaatatagaaggcgaagctacagctatgtatttatcgaagctc
ctaaaaccaatgggaatcaaggtttctagaatcgctcacggtatcccagtcggtggggac
cttgaatatgcagatgaggtcacattaaccaaggcactggaaggtagacgggagatttaa

DBGET integrated database retrieval system