KEGG   Amycolatopsis orientalis: AORI_0127Help
Entry
AORI_0127         CDS       T02678                                 

Gene name
mutM
Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
aoi  Amycolatopsis orientalis
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:aoi03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
131154..132017
Genome map
AA seq 287 aa AA seqDB search
MPELPEVEALAHHLREHAVGKTVFRVDVSSLSVLKTATPPWTELHGREVTGAGRFGKHLD
LVAGDLHLVVHLARAGWLRWSDALSPTPLKPGKGPISLRVHLDAAAGPGFDLTEAGTKKG
LAVWIVRDPEKEVASIARLGPDALSLDRTQLEKLFTGRTERLKTALTDQSLIAGIGNAYS
DEIMHMAKLSPYATTGKLSEAALDGLSEAIREVLTSAVTRSVGQSAARLKGEKRSGLRVH
ARTGLPCPVCGDTIREISFADKSFQYCPTCQTGGKPLADRRMSRLLK
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagttacccgaggtcgaagcgctcgctcaccacctgcgtgaacacgcggtgggc
aagacggtcttccgtgtcgacgtgtcgtccctcagcgtgctgaagacggcgacaccgccg
tggaccgagctgcacggccgcgaggtcaccggggcgggccggttcggcaaacatctggat
ctcgtcgccggcgatctccatctggtcgtccacctggcgagggcgggctggctgcgctgg
tccgacgcgttgtcgccgacgccgctcaaacccggcaaggggccgatctcgctgcgcgtc
cacctcgacgcggccgccgggccgggcttcgacctcacggaggccgggacgaagaagggc
ctggcggtctggatcgtgcgcgatccggagaaggaggtcgcgagcatcgcgcggctcggg
ccggacgcgctttcgctcgaccgcacgcagctcgagaagttgttcaccgggcgcaccgaa
cggttgaagacggcgctgaccgatcagtcgctgatcgccgggatcggcaacgcctactcc
gacgagatcatgcacatggcgaagctttccccttacgccacaaccggaaagctgtccgag
gcggcgctcgacgggctttcggaggcgatccgcgaggtgctgaccagcgccgtgacgcgt
tcggtcggccagtccgcggcccggctcaagggcgagaagcggtccgggctgcgggtgcac
gcgcgcacggggctgccgtgtccggtctgcggcgacacgatccgcgagatctcgttcgcg
gacaagtcgttccagtactgcccgacctgccagaccggcgggaaacccctcgcggaccgg
cggatgtcgcgcctgctgaagtga

DBGET integrated database retrieval system