KEGG   Amycolatopsis orientalis: AORI_0865Help
Entry
AORI_0865         CDS       T02678                                 

Gene name
deoA
Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
aoi  Amycolatopsis orientalis
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aoi00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    AORI_0865 (deoA)
Enzymes [BR:aoi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     AORI_0865 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
880496..881779
Genome map
AA seq 427 aa AA seqDB search
MSGFAAVDVIRAKRDGGRLTDEQIDWTIDAYTRGDIAEEQMAALAMAIFLRGMDSGEIAR
WTGAMISSGERLDLKVSRPTIDKHSTGGVGDKITLPLAPLVAACGAAVPQLSGRGLGHTG
GTLDKLESIPGWRASLSTSEIVRQLDEVGAVVCAATSGLAPADKKLYALRDVTSTVESIP
LIASSIMSKKIAEGSAGLVLDVKTGSGAFMKTLPQARELARTLVEIGTAHGVATTALITD
MNVPLGHAVGNAIEVAESVEVLRGGGPSDVVELTVALAREMLALAGLSDVDPAEVLASGR
AYETWCRMIAAQGGDPEAALPRPRHVHVVPAPADGVLSRLDAYAVGVAAWRLGAGRARKE
DPVQAAAGVLCLAKPGDTVSAGEPLLELHTDTPEAVPSALAALEDAYAVGSAGPSASAPL
VLETVRP
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgggttcgccgccgtcgacgtcatccgcgcgaagcgggacggtggacggctcacc
gacgagcagatcgactggaccatcgacgcgtacacgcgcggcgacatcgccgaggagcag
atggccgcgctcgcgatggccatcttcctgcggggcatggactccggggagatcgcgcgc
tggaccggcgcgatgatctcgtcgggggagcggctggacctgaaggtcagccgtccgacg
atcgacaagcattcgacgggcggggtcggcgacaagatcacgctcccgctggcgccgctc
gtcgcggcttgtggcgcggccgtgccgcagctgtccgggcgcgggctcgggcacactggc
gggacgctggacaaactggagtcgatccccggctggcgtgcctctttgtcgacatcggag
atcgtccggcagctcgacgaggtcggcgcggtggtctgtgcggcgacttccgggctggct
ccggcggacaagaagctgtacgcgttgcgggacgtgacttcgacggtggagtcgattccg
ctgatcgcgagctcgatcatgagcaagaagatcgccgagggctcggccgggctggtgctc
gacgtgaagacgggttcgggcgcgttcatgaagacgttgccgcaggcccgtgaactcgcg
cggacgctggtggagatcgggaccgcgcacggtgtcgcgacgacggcgctgatcacggac
atgaacgtgccgttgggccacgcggtcggcaacgcgatcgaggtcgcggagtcggtcgag
gtgctgcggggcggcggtccttccgacgtcgtcgagctgaccgtggcgttggcgcgggag
atgctggcgctggccggattgtccgatgtggacccggctgaggtgctggcttccggccgg
gcttacgagacgtggtgccggatgatcgccgctcagggcggggatccggaggccgctttg
ccgcggcctcgccatgtgcacgtggttccggcgcccgccgatggggttttgtcgcgtttg
gacgcttatgcggtcggggtcgccgcttggcggctcggggccgggcgggcgcgcaaggag
gatccggtgcaggccgccgcgggtgtcctgtgcctggcgaagccgggcgacaccgtgtcg
gccggggagccgctgctggagctgcacaccgatacgccggaggctgttccttcggctctc
gctgcgctcgaagacgcctacgcggtcggctccgctgggccttcggcctccgctccgctc
gtcctggagaccgtgcgcccctga

DBGET integrated database retrieval system