KEGG   Amycolatopsis orientalis: AORI_1911Help
Entry
AORI_1911         CDS       T02678                                 

Definition
glutamate dehydrogenase
Orthology
K15371  
glutamate dehydrogenase [EC:1.4.1.2]
Organism
aoi  Amycolatopsis orientalis
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
Taurine and hypotaurine metabolism
Nitrogen metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aoi00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    AORI_1911
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AORI_1911
   00330 Arginine and proline metabolism
    AORI_1911
  Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    AORI_1911
Enzymes [BR:aoi01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.2  glutamate dehydrogenase
     AORI_1911
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2050648..2055621
Genome map
AA seq 1657 aa AA seqDB search
MSSTGVSSLPGTDVGTEDGARRRSANPEQIRDDLIDAAAAYAPEIGDLIRLYYRHIPAEE
ILGDDPVDLVGAVRSHLQLAKDRMPGRPAVRLLNPTGPEDGWTREATVVQVVTDDMPYLV
DSVAAEFARDGVQVQRIVHPIVVVSRDLTGELLEVHPDADPAEPPANSAAESWMYIEIDL
VTDPNRARELDNRLSSVLGDVREVVEDTDKMTETARRLADELDGNPPRLPANEVAEGARL
LRWLADGHFTFLGYRRYELIDNPHPDSDEPALRAVLATGLGVLRQDSLAARSLTAGPDTA
ASALAPTLLVLTQASAPSTVHRPVYPYYVGVKTFDDNGNVTGEHRFLGMFTTTALHENVL
DIPVVCNRVREVIHRAGFPMESFSGQRMLEVLQNWPRADLFSADSDSLYSTTTGAITLSD
RRRLRLFLRRDPYGRFYSCLVYLPRDRYTTRSRLAMQEVLLEELEGTQLEYSARIGETVL
AQVHFIVHTDPSQRSEPDTLRIQERLNEAVRSWDDRMVEAILAERRERAGDSGVAIGLLV
EESAGEQGQRFAAVFPEGYKEDFTALEALADLRALESLTDEGDLSMSFYLPADAEAGERR
FKLYLRGEGVTLSQVLPVLQRMGVEVVDERPYELRREDGGRSWIYDFGLRIDPQVLDHAD
SDLRTRFQDAFHAAWRGDCEVDGFNGLVLRAGLTWRQAAILRAYSRYLRQTKIPFSQEYI
ENTVLAHTDIATALVRLFETRFDLALGDEARASQADQLTTEIGKLVDEVTSLDEDRILRR
LMSVILATLRTNYHVTDADGNSRQYLALKLDPSAVPELPEPRPKYEIFVYSPRIEGVHLR
FGDVARGGLRWSDRREDFRTEILGLVKAQAVKNAVIVPVGAKGGFVVKRPPAPTGDPGLD
RDAQLNEGIACYRMFISGLLDVTDNRVEGKTVPAPRVVRHDGDDSYLVVAADKGTAKFSD
IANEVSANYGFWLGDAFASGGSVGYDHKAMGITAKGAWESVKRNFRELGKDTQTEDFTVV
GIGDMMGDVFGNGMLLSEHIRLVAAFNHMHIFLDPNPDSATSFAERRRLFDLPRSSWEDY
DRSLISEGGGVYSRSAKTIPISPQVREALGLGEDVTKLAPNDLMQAILLAPVELLWNGGI
GTYVKAENESHADAGDKANDALRVNGNQLRVKVVGEGGNLGLTQLGRIEFARAGGKINTD
ALDNSAGVDCSDHEVNIKILLDHLVSTGSLDAEQRNELLEQMTDEVGELVLADNYRQNAV
LGVSRAHAGPMVSVHQRLVAALVAKGAFDRKLEALPSSAEFRALEKAGEGLTSPELATLL
AHVKLDLKDELLASELPDSEVFSRRLPEYFPKPLRERFGDAIFQHPLKREIITTMVANEV
VDGAGISYVFRLMEEMNATATDAVRAYAVVTHVYDLPSLWAQIDALDNVVPTEVADEMML
ETRRLLDRAARWFLTNRPQPLAPLAEINRFGRVVGELAPRAHELLRGVECASVDANTERL
IEKGVPAELAGRVALLLHTYGLLDVTDVAELAEQQAGIDAVHTPAETAGLYYALSDHLGI
DKMLTSISGLERGNRWHALARLALRDDVYGSLRTITLDALRHSDSGTDPDEKIAHWEKTN
ASRLQRARVALDEISQFGKLDLATLSVAARQIRSTVR
NT seq 4974 nt NT seq  +upstreamnt  +downstreamnt
atgagctcgacgggagtctcgtccctgcccggaacagatgtcggcaccgaggatggcgcc
cggcgccggtcggcgaacccggagcagatccgggacgacctgatcgacgccgccgcggcg
tacgccccggagatcggcgacctgatccgcctgtactaccggcacatcccggccgaagag
attctcggtgacgacccggtcgacctcgtcggcgcagtccgctcgcatctgcagctcgcg
aaggaccggatgcccggccgtcccgcggtgcggttgctgaacccgacggggcccgaggac
ggctggacgcgtgaggccaccgtggtgcaggtcgtcacggacgacatgccgtacctggtg
gattccgtcgcggccgagttcgctcgcgacggggtgcaggtgcagcgcatcgtgcacccg
atcgtcgtggtgagccgggatctgaccggtgagctgctggaggtccacccggacgccgac
ccggcggagccgccggcgaattcggcggccgaatcgtggatgtacatcgagatcgacctg
gtcacggacccgaaccgcgcccgcgagctggacaaccggctgtcttcggtgctgggtgac
gtccgcgaggtcgtcgaggacaccgacaagatgacggagacggcgcgccgtctcgccgac
gagctggacgggaacccgccgcggctgccggccaacgaggtcgcggaaggagcccggctg
ctgcgctggctcgccgacggccacttcaccttcctcggctaccgccggtacgagctgatc
gacaacccgcacccggacagcgacgagcccgccctgcgcgcggtgctcgccaccgggctc
ggcgtgctgcgtcaggacagtctggccgcgcgcagcctcaccgctggccccgacacggcg
gcctccgcgctcgcgccgacactgctggtgctgacccaggcgagcgcgccgtccaccgtg
caccgcccggtgtatccgtactacgtcggcgtgaaaacgttcgacgacaacgggaacgtc
accggcgaacaccgcttcctcggcatgttcaccaccaccgcgctgcacgagaacgtgctc
gacatccccgtggtctgcaaccgagtccgcgaggtcatccaccgcgcgggcttcccgatg
gagtccttctccggccagcggatgctcgaagtcctgcagaactggccgcgcgcggacctg
ttctcggccgactccgactcgctctactcgacgacgacgggcgcgatcacgctttcggat
cgcagacggctgcgcctgttcctgcgccgcgacccgtacggccgtttctactcgtgcctc
gtgtacctcccgcgtgaccgctacacgacccgttcgcggctcgcgatgcaggaggtcctg
ctcgaagaactagaaggcacgcagctggagtacagcgcgcgcatcggcgagaccgtgctc
gcgcaggtgcacttcatcgtgcacaccgatccgtcccagcgctccgaaccggacaccctg
cgcatccaggaacggctcaacgaggccgtgcgcagctgggacgaccggatggtcgaggcg
atcctcgccgagcgccgcgagcgcgccggggacagcggcgtcgcgatcggcctgctggtc
gaggagtcggcgggcgagcaggggcagcggttcgccgcggtgttccccgagggctacaag
gaggacttcaccgcgctcgaagcgctcgcggacctccgcgccctggagtcgctgaccgac
gagggcgacctgtcgatgtcgttctacctgccggccgacgccgaggcgggggagcggcgc
ttcaagctgtacctgcgcggcgagggcgtcacgctctcccaggtgctcccggtcctgcag
cggatgggcgtcgaggtcgtcgacgagcggccctacgaactgcgccgcgaggacggcggc
cggtcctggatctacgacttcggcctgcggatcgacccgcaggtcctcgaccacgccgac
agcgacctgcgcacccgcttccaggacgccttccacgccgcctggcgcggcgactgcgag
gtcgacggcttcaacggtctcgtcctgcgcgccgggctcacttggcgccaggcggccatc
ctgcgggcctattcgcggtacctgcgccagacgaagatcccgttctcgcaggagtacatc
gagaacaccgtcctcgcgcacacggacatcgccaccgcgctggtgcggctgttcgagacc
cgcttcgacctcgcgctcggcgacgaggcgcgcgcgtcgcaggccgatcagctcaccacc
gagatcggcaagctggtcgacgaggtgacgagcctcgacgaggaccggatcctgcggcgg
ctgatgtcggtcatcctcgccacgctgcgcacgaactaccacgtgaccgacgcggacggg
aactcccgccagtacctggcgctcaagctcgacccgagcgcggtgcccgagttgcccgag
ccgcggccgaagtacgagatcttcgtgtactcgccccggatcgagggtgtgcacctgcgc
ttcggcgacgtcgcgcgcggtggcctgcggtggtccgaccgccgggaggacttccgcacg
gagatcctcggcctggtcaaggcgcaggcggtcaagaacgcggtcatcgtgcctgtcggc
gccaagggcggcttcgtcgtgaagcgcccgccggcgcccacgggtgaccccggcctggac
cgcgacgcccagctgaacgagggcatcgcctgctaccggatgttcatctccggcctgctc
gacgtgaccgacaaccgcgtcgagggcaagaccgtcccggcgccgcgcgtggtccgtcac
gacggcgacgacagctacctcgtggtcgccgcggacaagggcaccgcgaagttctccgac
atcgcgaacgaggtctcggcgaactacgggttttggctcggcgacgccttcgcgtccggc
ggctcggtcggctacgaccacaaggccatgggcatcaccgcgaagggtgcttgggagagc
gtcaagcgcaacttccgtgagctgggcaaggacacccagaccgaggacttcaccgtcgtc
ggcatcggcgacatgatgggtgacgtcttcggcaacgggatgctgctctcggagcacatc
cggctcgtggccgccttcaaccacatgcacatcttcctcgacccgaacccggattcggcg
acctcgttcgccgagcggcgcaggctgttcgacctgccgcgctcctcgtgggaggactac
gaccgctcgctgatcagcgagggcggcggggtctactcgcggtcggcgaagacgatcccg
atcagcccgcaggtccgcgaggcgctcggcctcggcgaggacgtcacgaaactggcgccc
aacgacctgatgcaagcgatcctgctggccccggtcgagctgctgtggaacggcggcatc
ggcacctacgtgaaggccgagaacgagtcccacgcggacgcgggtgacaaggccaacgac
gccctgcgcgtcaacggcaaccagcttcgcgtcaaggtcgtcggcgagggcgggaacctg
ggcctgacccagctcggccggatcgagttcgcccgcgcgggcggcaagatcaacaccgac
gcgctcgacaactccgccggcgtggactgctcggaccacgaggtcaacatcaagatcctg
ctggaccacctggtctcgaccggatcgctggacgccgagcagcgcaacgaactgctcgag
cagatgaccgacgaggtcggcgagctggtgctggccgacaactaccggcagaacgcggtg
ctcggcgtcagccgggcgcacgccggcccgatggtctcggtgcaccagcggctcgtcgcg
gcgctggtcgcgaagggcgccttcgaccgcaagctcgaagcgctgccgagttcggcggag
ttccgcgcgctggagaaggcgggagagggcctcacctcgccggagctggcgacgttgctc
gcgcacgtcaagctcgacctcaaggacgagctgctggccagtgagctgccggactccgag
gtgttctcgcgccgcctgcccgagtacttcccgaagccgcttcgggagcgcttcggcgac
gcgatcttccagcacccgctgaagcgcgagatcatcacgacgatggtggccaacgaggtc
gtcgacggcgccgggatctcgtacgtcttccgcctgatggaggagatgaacgcgaccgcg
accgacgccgtccgcgcgtacgccgtggtcacccacgtgtacgaccttccctcgctgtgg
gcgcagatcgacgcgctggacaacgtcgtgccgaccgaggtcgcggacgagatgatgctg
gagacccgcaggctgctcgaccgggccgctcgctggttcctcaccaaccggccgcagccg
ctggccccgctcgccgagatcaaccggttcggccgcgtcgtcggcgagctggccccgagg
gcgcacgagctgcttcgcggtgtcgagtgcgcttcggtggacgcgaacaccgagcggctg
atcgagaagggcgtcccggcggaactcgccggacgggtggcgctgctgctgcacacctac
ggcctgctcgacgtcaccgacgtcgcggagctggccgagcagcaggcggggatcgacgcg
gtgcacaccccggcggagacggcgggcctgtactacgcgctgtccgaccacctcggcatc
gacaagatgctgacgtcgatcagcggtctcgaacgcggcaaccgctggcacgcgctcgcg
cggctggcgctgcgggacgacgtctacggttccctgcggacgatcacgctggacgccttg
cggcacagcgattcgggcaccgacccggacgagaagatcgcccactgggagaagacgaac
gcttcgcggttgcagcgggcccgtgtcgcgctggacgagatcagccagttcggcaagctc
gacctggcgacgctgtcggtggcggcgaggcagatccggagcacggtgaggtag

  All links  
No link information was found.   
DBGET integrated database retrieval system