KEGG   Amycolatopsis orientalis: AORI_2004Help
Entry
AORI_2004         CDS       T02678                                 

Gene name
proB
Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
aoi  Amycolatopsis orientalis
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:aoi01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:aoi00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2158645..2159739
Genome map
AA seq 364 aa AA seqDB search
MAIADAKRVVVKVGSSALTTAGDGLDVTRLDALVDAIADRVSRGTQIVLVSSGAIGAGLA
PLSLGKRPRDLATQQAAASVGQLALAHAYAESFGRFSLTVGQVLLTSDDVVRRAHYRNAQ
NTFTRLLALGAVPVVNENDTVATEEIRFGDNDRLAALVAHLIGADALVLLSDVDGLYDGD
PRDGATRKIAEVAGESDVDGITVGMSSSGLGTGGMVSKLAAARTAAGAGIPVLLAAASEA
ARALTTAEVGTAFAAADSRLSARRFWLGYAAGASGKLHLDDGAVAAVVRRRRSLLAAGIT
GVDGDFQAGDVVDLVDLRQRTVARGVVAFDAGELPDLIGRSSHDLPAEQRREVVHADDLV
PLRR
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
gtggcgatcgccgacgcgaagcgtgtggtcgtcaaggtcggttcctccgcactgaccacc
gccggcgacggtctcgacgtgaccaggctggacgcgttggtggacgcgatcgccgaccgg
gtctcccgcggcacacagatcgtgctggtgtcctcgggcgcgatcggcgcggggctcgcg
ccgctctcgctcggcaaacgaccgcgtgatctcgccacccagcaggccgcggccagtgtc
gggcagctcgcgctggcccacgcctacgccgagtcgttcggccggttttcgttgacagtg
ggccaggttctgctgacctcggacgacgtcgtgcgccgtgcgcactaccgcaacgcgcag
aacacgttcacccggctgctggccctcggcgccgttcccgtggtcaacgagaatgacacc
gtggccaccgaagagatccgcttcggcgacaacgaccggctggccgcgctggtggcgcac
ctgatcggcgccgacgcgctcgtcctcctgtccgatgtggacggtctgtacgacggggat
ccccgtgacggcgcgacccgcaagatcgccgaggtcgccggggagtccgatgtggacgga
atcaccgtcggcatgtcgagctccgggctcggcaccggcggcatggtgtcgaagctcgcc
gccgcccgcaccgccgccggcgccgggatcccggtcctgctcgccgccgcttccgaggcc
gcgcgcgccctgaccaccgccgaggtcggcacggcgttcgccgccgcggactcccggctg
tcggcccgccggttctggctgggctacgccgcgggcgcgtccgggaaactgcatctcgac
gacggcgcggtcgcggccgtcgtccgccgccgtcgctccctgctggccgccgggatcacc
ggcgtcgacggcgatttccaggcgggcgacgtcgtcgatctcgtcgatctccggcagcgg
accgtggcacggggtgtcgtggccttcgacgcgggcgaactgcccgacctcatcggacgc
tccagtcacgacctccccgcggaacagcgtcgcgaggtcgtccacgcggacgatctcgtt
cccctgcgccgctag

DBGET integrated database retrieval system