KEGG   Amycolatopsis orientalis: AORI_2631Help
Entry
AORI_2631         CDS       T02678                                 

Gene name
hemY
Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
aoi  Amycolatopsis orientalis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:aoi00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2807546..2808925
Genome map
AA seq 459 aa AA seqDB search
MKTVAVVGGGISGLTAAYRLRTLLGEDARIVVFEATGSLGGKLRTVELAGERYDVGAEAF
LARRPEALALVREVGLGESLVHPTKARAKIHAGGSVLGLPPGTVMGVPASAGAVAGMLSE
KGRALVEAEASLPPLELPAEDVPLGPLLRERFGDELVDRLVDPLLGGVYAGGADGLGLRA
TMPGLASAIDRGATSLTEGAASRLPASPSTAPVFGTLLGGLGTLIARLAELSRAEIRTGT
TVTALDRTPTGWKVDDLDADAVLLAVPAPSARRLLDGVAGVASSVFAKVELASMAVVALA
LPPGTALPESSGVLIGAGERDAAGKPFAAKAFTFSSRKWAQYGEGPVLVRGSVGRFGEPG
ALHADDDELVRVVRDDLARLTGVTAEPIDILVTRWGGGLPQYGTGHLVRVERIERAVAAV
PGLAVAGATLHGVGLPACIATADAAARRIAGITPPHEGS
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
gtgaagacggtcgccgtcgtcggtggcgggatctcgggactgaccgcggcgtaccggctg
cggaccctgctcggcgaggacgccaggatcgtcgtcttcgaggcgaccgggtcgctcggc
gggaaactccgcacggtcgaactcgccggtgagcgctacgacgtcggcgcggaggccttc
ctcgcccgccgtcccgaagcgctcgcgctggtgcgtgaggtcgggctgggcgaaagcctc
gtccatcccaccaaggcccgcgcgaagatccacgccggcggttccgtactcggcctgccg
ccgggcacggtcatgggtgttccggcgtcggccggcgcggtcgcggggatgctgtcggag
aagggccgcgcgctggtcgaggccgaggcgtcgctgcctccgctggaactgcccgcggaa
gatgtgccgctcggcccgctgctgcgcgaacggttcggcgacgaactcgtcgaccggctc
gtcgatccgctgctcggcggggtctacgccgggggagcggacgggctcggcctgcgcgcg
accatgcccggcctcgcctccgcgatcgatcgcggcgcgacttcgctcaccgaaggcgcc
gcctcccgcctgcccgcctcgccgagtacggcgccggtcttcggcaccctgctgggcggg
ctcgggacgctgatcgctcggctcgcggagctgtcccgcgccgagatccgcaccgggacc
acggtgacggcgctcgaccgcacccccaccggctggaaggtcgacgacctcgacgccgac
gccgtccttctcgccgtcccggcgccctcggcgcggcggctgctcgacggcgtcgcggga
gtggcctcgtcggtgttcgcgaaggtcgaactcgcgtcgatggcggtggtcgcgctcgcg
ctcccgccggggaccgcgctgccggagtcgtccggggtgctgatcggcgccggggaacgg
gacgccgccgggaagccgttcgccgccaaggcgttcaccttctcgtcccgcaagtgggcg
cagtacggcgaaggtccggtgctggtgcgcggctcggtcggccgcttcggcgaaccgggc
gcgctgcacgccgacgacgacgaactcgtgcgcgtggtccgcgacgatctcgcccggctg
accggggtcaccgccgagccgatcgacatcctcgtgacccgatggggtggcggactcccg
cagtacggcaccgggcacctcgtccgcgtcgagcggatcgaacgtgccgtcgccgccgtt
cccgggctcgccgtggctggcgcgacactgcacggcgtcgggcttccggcctgcatcgcc
accgccgacgccgccgcccgccgcatcgccgggatcacaccgccccacgaaggctcctga

DBGET integrated database retrieval system