KEGG   Amycolatopsis orientalis: AORI_3690Help
Entry
AORI_3690         CDS       T02678                                 

Gene name
mhpF
Definition
acetaldehyde dehydrogenase
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
aoi  Amycolatopsis orientalis
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:aoi00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    AORI_3690 (mhpF)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AORI_3690 (mhpF)
   00650 Butanoate metabolism
    AORI_3690 (mhpF)
  Amino acid metabolism
   00360 Phenylalanine metabolism
    AORI_3690 (mhpF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AORI_3690 (mhpF)
   00622 Xylene degradation
    AORI_3690 (mhpF)
   00621 Dioxin degradation
    AORI_3690 (mhpF)
Enzymes [BR:aoi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     AORI_3690 (mhpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4068082..4068984
Genome map
AA seq 300 aa AA seqDB search
MAQRKAVAAIVGPGNIGTDLLAKLRRSEHVEVRYMVGVDPESDGLAKAAELGLETSAGGV
DWLLSRDELPDLVFEATSAKAHLANAPRYATAGIRAIDLTPAAVGPFTCPAVGLPDRLDV
PNVNLITCGGQATIPIVHAVSRVTPVPYAEIVASVSSRSAGPGTRANIDEFTATTARGIE
LVGGASRGKAIIIINPVEPPMIMRDTVFCAIDPDADFDAVSESIHRMVETVQGYVPGYTL
KADPQYDPPRPGWSGQARVAVFLEVAGNGDFLPKYAGNLDIMTAAAARIGDLLATQEVAA
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaacggaaagcggtggccgcgatcgtcggtcccgggaacatcggcaccgacctg
ctcgcgaagctgaggcgcagcgagcacgtcgaggtgcggtacatggtcggcgtggacccg
gagtcggacgggctggcgaaggccgcggagctggggttggagacatccgccggcggtgtg
gactggctgctttcgcgggacgaactgccggacttggtcttcgaggcgacttcggcgaag
gcgcatctggcgaacgcgccgcgctacgccaccgccgggatccgcgcgatcgacctgacc
ccggccgcggtcggcccgttcacctgccccgcggtgggcctgcccgaccggctcgacgtg
cccaacgtcaacctcatcacctgcggcggtcaggccacgatcccgatcgtgcacgcggtg
tcgcgggtgacgccggtgccctacgccgagatcgtcgcgtccgtctcgtcgcgttcggcc
gggcccggcacgcgcgcgaacatcgacgagttcaccgccacgacggcgcgcgggatcgaa
ctcgtcgggggagcgagccgcggcaaggcgatcatcatcatcaacccggtcgagccgccg
atgatcatgcgcgacaccgtgttctgcgcgatcgacccggacgcggacttcgacgcggtg
agtgaatccatccaccggatggtcgagaccgtccaaggttacgtgccgggctacacgctc
aaggcggatccgcagtacgacccaccacggccggggtggagcgggcaggcgcgggtcgcg
gtgttcctggaggtcgccgggaacggggacttcctgccgaaatacgccgggaatctcgac
atcatgacggccgcggccgcccgtatcggcgaccttctggccactcaggaggtggcggca
tga

DBGET integrated database retrieval system