KEGG   Amycolatopsis orientalis: AORI_3690Help
Entry
AORI_3690         CDS       T02678                                 

Gene name
mhpF
Definition
(GenBank) acetaldehyde dehydrogenase
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
aoi  Amycolatopsis orientalis
Pathway
aoi00360  Phenylalanine metabolism
aoi00362  Benzoate degradation
aoi00620  Pyruvate metabolism
aoi00621  Dioxin degradation
aoi00622  Xylene degradation
aoi00650  Butanoate metabolism
aoi01100  Metabolic pathways
aoi01120  Microbial metabolism in diverse environments
aoi01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:aoi00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AORI_3690 (mhpF)
   00650 Butanoate metabolism
    AORI_3690 (mhpF)
  Amino acid metabolism
   00360 Phenylalanine metabolism
    AORI_3690 (mhpF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AORI_3690 (mhpF)
   00622 Xylene degradation
    AORI_3690 (mhpF)
   00621 Dioxin degradation
    AORI_3690 (mhpF)
Enzymes [BR:aoi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     AORI_3690 (mhpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh NAD_binding_3 Glu_dehyd_C
Motif
Other DBs
NCBI-ProteinID: AGM06275
UniProt: R4SUQ4
Position
4068082..4068984
Genome map
AA seq 300 aa AA seqDB search
MAQRKAVAAIVGPGNIGTDLLAKLRRSEHVEVRYMVGVDPESDGLAKAAELGLETSAGGV
DWLLSRDELPDLVFEATSAKAHLANAPRYATAGIRAIDLTPAAVGPFTCPAVGLPDRLDV
PNVNLITCGGQATIPIVHAVSRVTPVPYAEIVASVSSRSAGPGTRANIDEFTATTARGIE
LVGGASRGKAIIIINPVEPPMIMRDTVFCAIDPDADFDAVSESIHRMVETVQGYVPGYTL
KADPQYDPPRPGWSGQARVAVFLEVAGNGDFLPKYAGNLDIMTAAAARIGDLLATQEVAA
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaacggaaagcggtggccgcgatcgtcggtcccgggaacatcggcaccgacctg
ctcgcgaagctgaggcgcagcgagcacgtcgaggtgcggtacatggtcggcgtggacccg
gagtcggacgggctggcgaaggccgcggagctggggttggagacatccgccggcggtgtg
gactggctgctttcgcgggacgaactgccggacttggtcttcgaggcgacttcggcgaag
gcgcatctggcgaacgcgccgcgctacgccaccgccgggatccgcgcgatcgacctgacc
ccggccgcggtcggcccgttcacctgccccgcggtgggcctgcccgaccggctcgacgtg
cccaacgtcaacctcatcacctgcggcggtcaggccacgatcccgatcgtgcacgcggtg
tcgcgggtgacgccggtgccctacgccgagatcgtcgcgtccgtctcgtcgcgttcggcc
gggcccggcacgcgcgcgaacatcgacgagttcaccgccacgacggcgcgcgggatcgaa
ctcgtcgggggagcgagccgcggcaaggcgatcatcatcatcaacccggtcgagccgccg
atgatcatgcgcgacaccgtgttctgcgcgatcgacccggacgcggacttcgacgcggtg
agtgaatccatccaccggatggtcgagaccgtccaaggttacgtgccgggctacacgctc
aaggcggatccgcagtacgacccaccacggccggggtggagcgggcaggcgcgggtcgcg
gtgttcctggaggtcgccgggaacggggacttcctgccgaaatacgccgggaatctcgac
atcatgacggccgcggccgcccgtatcggcgaccttctggccactcaggaggtggcggca
tga

DBGET integrated database retrieval system