KEGG   Amycolatopsis orientalis: AORI_3750Help
Entry
AORI_3750         CDS       T02678                                 

Definition
glutamate dehydrogenase (NAD(P)+)
Orthology
K00261  
glutamate dehydrogenase (NAD(P)+) [EC:1.4.1.3]
Organism
aoi  Amycolatopsis orientalis
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Nitrogen metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:aoi00910]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:aoi00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:aoi00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:aoi00471]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4119405..4120592)
Genome map
AA seq 395 aa AA seqDB search
MAARNAEPLMRLVWTDPVTGATGYLVVHSLVSGIATGGTRMRAGCTMTEVEDLARGMANK
TATFGLPVGGAKGGIDFDPKDERAFGVLERFCSFLRPWIDNHWVTAEDLGVPQHLIDEVF
AKLGLEQSYHAAIRRSADPAHTLRRVQAGLNTPVPGGLLLGDVIGGYGVAQACLGVADAW
EWAADETTVAIQGIGTMGGGAAWYLHEAGMKVVAVADAAGTLYRPEGLDIPALLELRDSY
GEVDRSRLPADVQLLPRDEIVGTEADILVPAAISYALRAGNQGVVKAKVVIEAANAATTP
DAEAGLAARGIPVIPDFVANAGAAAWAWWLLLGEVGADPADSFLRLRTEMRAKVALLLSS
WNLDRIAPRTTGLRLAETTRSDAATPETAPALVIP
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgaggaacgccgaaccgctgatgaggctcgtctggaccgaccccgtcaccggt
gccaccggctacctcgtagtgcacagcctggtctccggcatcgcgaccggcgggacccgg
atgcgcgcgggctgcacgatgaccgaggtcgaggacctggcgagggggatggcgaacaag
accgcgaccttcggcctgccggtcggcggggccaagggcggtatcgacttcgatccgaag
gacgagcgtgctttcggtgtgctggaacggttctgctcgttcctgcggccgtggatcgac
aaccactgggtgaccgccgaagacctcggcgtgccacagcacctgatcgacgaggtgttc
gcgaagctcgggctggagcagtcgtaccacgccgcgatccgtcgttcggccgatccggcg
cacacccttcgccgcgtgcaggccgggctgaacacaccggtccccggcgggcttctgctc
ggcgacgtgatcggcggctacggcgtcgcgcaggcctgcctcggtgtcgccgacgcgtgg
gaatgggccgccgacgagaccacggtcgccatccagggcatcggcacgatgggcggcggc
gcggcctggtacctgcacgaagccgggatgaaggtcgtcgcggtcgccgacgcggccggc
acgctgtaccggcccgaaggtctcgacatcccggcgctgctggaactgcgcgactcctac
ggcgaggtcgaccggagccggctccccgccgacgtacagcttctcccccgcgacgagatc
gtggggaccgaggcggacatcctcgtcccggcggccatctcctacgcgttgcgcgccggg
aaccagggcgtcgtcaaggcgaaggtcgtcatcgaagcggccaacgcggcgaccacaccc
gacgcggaagcggggctggcggcccgcggcatcccggtgatcccggacttcgtcgcgaac
gccggcgcggccgcgtgggcctggtggctcctgctcggcgaggtcggcgccgatcccgcc
gattcgttcctgcgcctgcggaccgagatgcgggcgaaggtggccctgctgctgagctcg
tggaacctcgaccggatcgcaccccgcaccacgggattgcgactggccgaaaccacccgt
tcggacgccgccaccccggaaaccgcccccgcgctggtcatcccctga

DBGET integrated database retrieval system