KEGG   Amycolatopsis orientalis: AORI_3750Help
Entry
AORI_3750         CDS       T02678                                 

Definition
(GenBank) glutamate dehydrogenase (NAD(P)+)
  KO
K00261  glutamate dehydrogenase (NAD(P)+) [EC:1.4.1.3]
Organism
aoi  Amycolatopsis orientalis
Pathway
aoi00220  Arginine biosynthesis
aoi00250  Alanine, aspartate and glutamate metabolism
aoi00471  D-Glutamine and D-glutamate metabolism
aoi00910  Nitrogen metabolism
aoi01100  Metabolic pathways
aoi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aoi00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    AORI_3750
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AORI_3750
   00220 Arginine biosynthesis
    AORI_3750
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    AORI_3750
Enzymes [BR:aoi01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.3  glutamate dehydrogenase [NAD(P)+]
     AORI_3750
Exosome [BR:aoi04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   AORI_3750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ELFV_dehydrog ELFV_dehydrog_N ApbA 3HCDH_N 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AGM06335
UniProt: R4SUX4
Position
complement(4119405..4120592)
Genome map
AA seq 395 aa AA seqDB search
MAARNAEPLMRLVWTDPVTGATGYLVVHSLVSGIATGGTRMRAGCTMTEVEDLARGMANK
TATFGLPVGGAKGGIDFDPKDERAFGVLERFCSFLRPWIDNHWVTAEDLGVPQHLIDEVF
AKLGLEQSYHAAIRRSADPAHTLRRVQAGLNTPVPGGLLLGDVIGGYGVAQACLGVADAW
EWAADETTVAIQGIGTMGGGAAWYLHEAGMKVVAVADAAGTLYRPEGLDIPALLELRDSY
GEVDRSRLPADVQLLPRDEIVGTEADILVPAAISYALRAGNQGVVKAKVVIEAANAATTP
DAEAGLAARGIPVIPDFVANAGAAAWAWWLLLGEVGADPADSFLRLRTEMRAKVALLLSS
WNLDRIAPRTTGLRLAETTRSDAATPETAPALVIP
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgaggaacgccgaaccgctgatgaggctcgtctggaccgaccccgtcaccggt
gccaccggctacctcgtagtgcacagcctggtctccggcatcgcgaccggcgggacccgg
atgcgcgcgggctgcacgatgaccgaggtcgaggacctggcgagggggatggcgaacaag
accgcgaccttcggcctgccggtcggcggggccaagggcggtatcgacttcgatccgaag
gacgagcgtgctttcggtgtgctggaacggttctgctcgttcctgcggccgtggatcgac
aaccactgggtgaccgccgaagacctcggcgtgccacagcacctgatcgacgaggtgttc
gcgaagctcgggctggagcagtcgtaccacgccgcgatccgtcgttcggccgatccggcg
cacacccttcgccgcgtgcaggccgggctgaacacaccggtccccggcgggcttctgctc
ggcgacgtgatcggcggctacggcgtcgcgcaggcctgcctcggtgtcgccgacgcgtgg
gaatgggccgccgacgagaccacggtcgccatccagggcatcggcacgatgggcggcggc
gcggcctggtacctgcacgaagccgggatgaaggtcgtcgcggtcgccgacgcggccggc
acgctgtaccggcccgaaggtctcgacatcccggcgctgctggaactgcgcgactcctac
ggcgaggtcgaccggagccggctccccgccgacgtacagcttctcccccgcgacgagatc
gtggggaccgaggcggacatcctcgtcccggcggccatctcctacgcgttgcgcgccggg
aaccagggcgtcgtcaaggcgaaggtcgtcatcgaagcggccaacgcggcgaccacaccc
gacgcggaagcggggctggcggcccgcggcatcccggtgatcccggacttcgtcgcgaac
gccggcgcggccgcgtgggcctggtggctcctgctcggcgaggtcggcgccgatcccgcc
gattcgttcctgcgcctgcggaccgagatgcgggcgaaggtggccctgctgctgagctcg
tggaacctcgaccggatcgcaccccgcaccacgggattgcgactggccgaaaccacccgt
tcggacgccgccaccccggaaaccgcccccgcgctggtcatcccctga

DBGET integrated database retrieval system