KEGG   Amycolatopsis orientalis: AORI_3875Help
Entry
AORI_3875         CDS       T02678                                 

Definition
endoglucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
aoi  Amycolatopsis orientalis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aoi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AORI_3875
Enzymes [BR:aoi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     AORI_3875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4244868..4245947
Genome map
AA seq 359 aa AA seqDB search
MRWDKIRLRVTAALAAGLLAPVAAASTSMATETAAEPATQAVAALPPGSPAAINGQLKVC
GLQLCNSAGKPIQLRGMSTHGIQWFSQCVKTASLDALANDWKADVLRISMYIQEGGYETN
PRKFTDMVHGYIEEATKRGMYALVDWHQLTPGDPNANLSRAKTFFTEIAQRHKDKTNIIY
DIANEPNNVSWDRVRSYAEQMIPVIRAQDSDGVVLVGTHGWGSLGISDGRNETDIINNPV
RASNFMYTFHFYAASHKTEYFNALSRAASKIPLFVTEFGTQTASGDGGNDFTNSQKYLDF
LASKKISWTNWNFSDDSRSGAVFKPGTCSGSSFTGTAPLKPAGVWIRDRIRTADNFPTS
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgcgctgggacaagatccgactccgggtgacggccgcactggccgccgggctgctggcc
ccggtcgccgccgcgagcacctcgatggcgaccgagaccgcggcagaacccgcgacgcag
gccgttgccgcgctgccgccgggcagtccggcggcgatcaacgggcagctgaaggtctgc
ggcctccagctctgcaactccgccggcaagccgatccagctccggggcatgagcacccac
gggatccagtggttcagccagtgtgtgaagaccgcttcgctcgacgcgctggccaacgac
tggaaggccgacgtcctgcggatctccatgtacatccaggagggcggctacgagaccaac
ccgcgcaagttcaccgacatggtgcacgggtacatcgaggaggccaccaagcgcgggatg
tacgcgctggtcgactggcaccagctcacccccggtgacccgaacgcgaacctcagccgc
gccaagacgttcttcaccgagatcgcccagcggcacaaggacaagaccaacatcatctac
gacatcgccaacgagcccaacaacgtcagctgggaccgcgtccgcagctacgcggagcag
atgatcccggtcatccgcgcccaggactccgacggcgtcgtgctggtgggcacccacggc
tggggctcgctcggcatctccgacggccgcaacgagaccgacatcatcaacaacccggtg
cgcgccagcaacttcatgtacacgttccacttctacgcggcgtcgcacaaaacggagtac
ttcaacgcgctgagccgcgccgcgagcaagatcccgctgttcgtgaccgagttcggcacc
cagaccgccagcggtgacggcggcaacgacttcaccaactcccagaagtacctggacttc
ctggcgtcgaagaagatcagctggaccaactggaacttctccgacgacagccgttcgggc
gcggtgttcaagccgggcacctgctcgggcagctcgttcaccggcacggctccgctgaag
cccgccggtgtctggatccgggaccgcatccgcaccgcggacaacttcccgacctcctga

DBGET integrated database retrieval system