KEGG   Amycolatopsis orientalis: AORI_3981Help
Entry
AORI_3981         CDS       T02678                                 

Gene name
tdk
Definition
thymidine kinase
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
aoi  Amycolatopsis orientalis
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:aoi00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4344773..4345552
Genome map
AA seq 259 aa AA seqDB search
MPIGSGVVTVLKESGPDPTDALSSVPVAGSRRGVPVVGKLKFCYGPMDCGKSTLALQIDH
NHARQGRRGMVLVRHDRSGEPQITSRIGLTRKAIEVGNETDLRLLVREQWAAGRHVDYLI
VDEAQFLSPDQVDQLAELADDVQIDVYCFGIATDFRSMLFPGAARLFELADELQPVQVEV
LCWCGQTGRFNARVSDGEVLRAGDTVVVADTEQSLVESSPASRSEGESNTVRYQVLCRRH
FRLGDLGPTSAQHGQLRLT
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
gtgccgatagggtcgggcgtcgtgaccgtactgaaggagagtggcccggatcccacggac
gcgttgtcgtcggtgccggtggcgggttcacggcggggtgtgccggtcgtcgggaagttg
aagttctgttacgggccgatggactgcgggaagtcgacgctggcgttgcagatcgaccac
aaccacgcgcggcagggtcgtcgcgggatggtgctggtgcggcatgaccggtccggggag
ccgcagatcaccagccggatcgggttgacgcgcaaggcgatcgaggtggggaacgagacc
gatctgcggttgctggtgcgtgagcagtgggcggccgggcggcatgtggactacttgatc
gtcgacgaggcgcagttcttgtcgcccgatcaggtggatcagctggctgaactggccgat
gacgtccagatcgacgtgtactgcttcgggatcgcgacggatttccggagcatgttgttc
ccgggggccgcgcggttgttcgagctggcggacgagttgcagccggtgcaggtcgaggtg
ttgtgctggtgcgggcagacgggacggttcaacgcgcgggtttccgacggtgaggtgctg
cgggccggggacaccgtggtggtcgcggataccgagcagtcgctagttgaaagttcaccg
gcatcacggtccgagggtgagtcgaacacggtccgttatcaggtattgtgccgtcggcac
tttcgactgggcgacctggggcccacctcagcccaacacggtcagttacggttgacgtga

DBGET integrated database retrieval system