KEGG   Amycolatopsis orientalis: AORI_3981Help
Entry
AORI_3981         CDS       T02678                                 

Gene name
tdk
Definition
thymidine kinase
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
aoi  Amycolatopsis orientalis
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aoi00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    AORI_3981 (tdk)
Enzymes [BR:aoi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     AORI_3981 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4344773..4345552
Genome map
AA seq 259 aa AA seqDB search
MPIGSGVVTVLKESGPDPTDALSSVPVAGSRRGVPVVGKLKFCYGPMDCGKSTLALQIDH
NHARQGRRGMVLVRHDRSGEPQITSRIGLTRKAIEVGNETDLRLLVREQWAAGRHVDYLI
VDEAQFLSPDQVDQLAELADDVQIDVYCFGIATDFRSMLFPGAARLFELADELQPVQVEV
LCWCGQTGRFNARVSDGEVLRAGDTVVVADTEQSLVESSPASRSEGESNTVRYQVLCRRH
FRLGDLGPTSAQHGQLRLT
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
gtgccgatagggtcgggcgtcgtgaccgtactgaaggagagtggcccggatcccacggac
gcgttgtcgtcggtgccggtggcgggttcacggcggggtgtgccggtcgtcgggaagttg
aagttctgttacgggccgatggactgcgggaagtcgacgctggcgttgcagatcgaccac
aaccacgcgcggcagggtcgtcgcgggatggtgctggtgcggcatgaccggtccggggag
ccgcagatcaccagccggatcgggttgacgcgcaaggcgatcgaggtggggaacgagacc
gatctgcggttgctggtgcgtgagcagtgggcggccgggcggcatgtggactacttgatc
gtcgacgaggcgcagttcttgtcgcccgatcaggtggatcagctggctgaactggccgat
gacgtccagatcgacgtgtactgcttcgggatcgcgacggatttccggagcatgttgttc
ccgggggccgcgcggttgttcgagctggcggacgagttgcagccggtgcaggtcgaggtg
ttgtgctggtgcgggcagacgggacggttcaacgcgcgggtttccgacggtgaggtgctg
cgggccggggacaccgtggtggtcgcggataccgagcagtcgctagttgaaagttcaccg
gcatcacggtccgagggtgagtcgaacacggtccgttatcaggtattgtgccgtcggcac
tttcgactgggcgacctggggcccacctcagcccaacacggtcagttacggttgacgtga

DBGET integrated database retrieval system