KEGG   Amycolatopsis orientalis: AORI_5882Help
Entry
AORI_5882         CDS       T02678                                 

Gene name
phoD
Definition
alkaline phosphatase D
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
aoi  Amycolatopsis orientalis
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:aoi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AORI_5882 (phoD)
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    AORI_5882 (phoD)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AORI_5882 (phoD)
Enzymes [BR:aoi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     AORI_5882 (phoD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6647253..6648788
Genome map
AA seq 511 aa AA seqDB search
MSVNRRDLLRGAATAGALGLAWPLSSRMTVAQAEEAAVALGATWDEAPFTLGVASGDPVP
YGVALWTRLAPKPMEFEQPLDDTVEVGWEVATDRGFRRRVARGTTAATAGLGHSVHVPVS
GLEPGAQYYYRFHALGKVSRVGRTRTAPVGPVRRVRFASANCQAFHDGFYAAHAGIAREE
LDFVVHLGDYVYEHGQVGGNPLRDHEGPEVLTLPAYRRRHALYKSDPSLRDAHAAHPWFI
TWDDHEVVNDYSGTTPSLRARRSAAYQAWFEHMPVRPDHPSTPRIHRQRHWGDLLDLSIL
DLRQYRSAQNLPDGTILGADQKAWLKDQVTGAGEAWHCWVNSIMLSQLAKPGGGYMFTDQ
WDGFLAERKEVLTHVAQSGLEDLVVITGDWHSAFVDDIRPDFADPATPVIGTEFTAHSIT
SGAYSPEWNATNGPKMGAANPHLKYFEGDRYGYDVYEVTPRRWSTHMRVIGDRRDPRSPV
STLTTFHVDRGRPGSYEDRSTSTSPAQYRRH
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtgaaccgccgggacctgttgcgaggcgccgccaccgccggtgcgctggggctg
gcctggccgttgagttcgcggatgacggtcgcgcaggccgaggaggccgccgtcgcactg
ggcgcgacctgggacgaggcgccgttcacgctcggcgtcgcgtccggcgacccggtcccg
tacggcgtggcgctctggaccaggctcgcgccgaagccgatggagttcgagcagccactg
gacgacaccgtcgaggtcggctgggaggtggccaccgaccgcggcttccgccgccgcgtg
gcgcgcgggacgacggccgccaccgccgggctcgggcacagcgtgcacgtcccggtgtcc
gggttggagccgggcgcgcagtactactaccgcttccacgcgctcggcaaggtaagccgg
gtcggccgcacccgcaccgcgccggtcgggccggtccggcgggtgcggttcgcctcggcg
aactgccaggcgttccacgacgggttctacgcggcgcacgccgggatcgcgcgggaggag
ctcgatttcgtcgtccacctcggtgactacgtctacgagcacggtcaggtcggcggcaac
ccgctgcgcgaccacgaagggcccgaggtgctgaccctgccggcgtaccggcggcggcac
gcgctctacaaatccgacccctcgctgcgggacgcccacgcggcccacccctggttcatc
acctgggacgatcacgaggtcgtcaacgactacagcggcaccaccccgtcgttgcgggcg
cggcgctcggcggcgtatcaggcctggttcgagcacatgccggtgcgcccggatcacccc
tcgacgccgaggatccaccggcagcgccactggggcgacctcctcgatctgtccattttg
gacttgcgacagtaccggtcggcgcagaacctgcccgacggcacgatcctcggcgcggat
cagaaggcgtggctcaaggaccaggtgaccggcgcgggcgaggcctggcactgctgggtg
aactcgatcatgctgagccagctggcgaagcccggcggcggctacatgttcacggaccag
tgggacggcttcctcgccgaacgcaaggaggtgctgacccacgtggcacagagcggcctg
gaagacctcgtggtgatcaccggcgactggcattccgcgttcgtcgacgacatccgcccg
gacttcgcggaccccgccaccccggtgatcggcacggagttcaccgcgcattcgatcacc
tccggtgcctactcccccgagtggaacgccacgaacgggccgaagatgggcgcggcgaac
ccgcacctcaagtacttcgaaggcgaccggtacggctacgacgtctacgaggtcaccccg
cgccgctggagtacgcacatgcgggtgatcggcgaccggcgcgacccgcgttccccggtg
agcaccctgacgacgttccacgtcgaccgcggcaggcccgggtcctacgaggaccggtcc
accagcacgtctccggcacagtaccggcgccactag

DBGET integrated database retrieval system