KEGG   Amycolatopsis orientalis: AORI_6271Help
Entry
AORI_6271         CDS       T02678                                 

Definition
hypothetical protein
Orthology
K16149  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
aoi  Amycolatopsis orientalis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:aoi00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7060709..7062220
Genome map
AA seq 503 aa AA seqDB search
MSEYEGTFCLVVHSHLPWLPHHGSWPVGEEWLYQAWAHSYLPMVDLLRRFADEGREDVLT
LGMTPILAAQLDDPYSIDAFHDWLGHWQLRSWHASTLWRGDPLLRDLAASEYRTAIKASE
ELETRWRHGFSPILRSFVDNGTIELLGGPLAHPFQPLLDPAVRDFMLRGGLADTALRIGR
RPEGIWAPECGYAPGMETGYAAAGVQRFMVDGPSLHGDTSAARTVGDSDVVCFGRDLEVT
YRVWSPKAGYPGHAAYRDFHTWAHEVGLKPSRVTGKTVEPPDKAPYDPAMATATLGGHVQ
DFVDTVVARLRSLKAEHGRESLVVAAYDTELFGHWWHEGPAWLEGVLRALPEAGVRVTTL
KGALEAGHLGGKVDLPASSWGSGKDWRVWDGEQVADMVRDNTALQDRMLDLVAGMDTTTR
DSVRDQAVAEAMLALSSDWAFMVTKDSAADYARRRAKVHTERFDTLAGLLRDGALDRARE
TAAAFRRDDGPFGHVDARDLLRK
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagtacgaaggcacgttctgcctcgtcgtgcacagccatctgccgtggctgccg
caccacggatcctggccggtcggcgaggaatggctctaccaggcgtgggcgcattcctac
ctgccgatggtcgatctcttgcgccgcttcgccgacgagggccgcgaagacgtcctcacc
ctcgggatgacgccgatcctcgccgcccagctcgacgacccgtacagcatcgacgccttc
cacgactggctcggccactggcagctgcgctcctggcacgcgtccacgctgtggcgcggc
gacccgctgctgcgcgacctcgcggcgagtgagtaccggacggcgatcaaggcctcggaa
gagctcgaaacccgctggcggcacggtttctcaccgatccttcggtcctttgtggacaac
gggacgatcgaactgctcggcggcccgctggcgcatccgttccagccgctgctcgacccg
gcggtccgcgacttcatgctgcgcggcggcctggccgacaccgcgctgcggatcggacgg
cgtcccgaaggcatttgggcacccgaatgcggctacgcgcccggtatggaaaccggctac
gccgccgcgggcgtccagcggttcatggtcgacggtccttccctgcacggtgacacctcg
gcggcccggaccgtcggcgattccgacgtcgtgtgtttcggccgcgacctcgaagtcacg
taccgcgtctggtcaccgaaggccggatatcccggccacgccgcctatcgcgacttccac
acctgggcccacgaagtcggcctcaaaccctcgcgggtgaccggcaagaccgtcgaaccg
ccggacaaggcgccgtacgacccggcgatggcgacggccaccctcggcggccacgtccag
gacttcgtcgacaccgtcgtcgcccgcctgcgctcgctcaaggccgagcacggccgcgaa
tcgctcgtcgtcgccgcgtacgacaccgaactcttcggacactggtggcacgagggcccg
gcctggctcgaaggcgtcctgcgcgcgctgcccgaagcaggcgtccgcgtcacgacgctc
aagggcgcgctcgaagccggtcatctcggcgggaaggtcgatctcccggcgtcgtcgtgg
ggctcgggcaaggactggcgggtctgggacggcgagcaggtcgccgacatggtgcgggac
aacaccgccctacaggaccggatgctcgacctcgtcgccggaatggacaccacgacgcgt
gactccgtccgcgatcaggccgtggccgaagcgatgctggcgctttcgagcgactgggcg
ttcatggtcaccaaggactccgccgccgattacgcgcggcggcgggcgaaagtgcacacg
gaacggttcgacacgctcgccggactgctccgggacggtgcgctcgaccgcgcgcgggag
accgcggccgcgttccggcgcgacgacgggccgttcggtcacgtcgacgcgcgtgatctg
ctgaggaaatga

DBGET integrated database retrieval system