KEGG   Amycolatopsis orientalis: AORI_6275Help
Entry
AORI_6275         CDS       T02678                                 

Definition
glycosyl transferase
Orthology
K16150  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
aoi  Amycolatopsis orientalis
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:aoi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AORI_6275
Enzymes [BR:aoi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     AORI_6275
Glycosyltransferases [BR:aoi01003]
 Polysaccharide
  Storage polysaccharide
   AORI_6275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7066102..7067355
Genome map
AA seq 417 aa AA seqDB search
MRVLMLSWEYPPVVVGGLARHVHALARHLARQGHDVVVLCRHTAGTDAETHPRTDRVVEG
VRIIRVAEDPMHVTFERDLVAWTLAMGHAMVRAATDLLRTWQPDVVHAHDWLVTHPAIAI
AEAARVPLVGTIHATEAGRHSGWLSHPLNQQVHSVEWWLANRSDALITCSQAMRREVAHL
FEVDADAVTVIHNGIEERTWQVPEEEVAHAREVYSPSGAPLLLYFGRLEWEKGVQDLLAA
LPRIRRAKPGTRLVVAGKGRHLEELVDQARKLRVRRAVDFVGHLSDRELRAVLAAADAVV
LPSRYEPFGIVALEAAAAKAPLVASTAGGLGEVVVDGETGLAFSPGDVEALGDAVEAVLD
DEVAAARRALTAQSRLAADFDWGRIAEATVAVYRRARVGEPVELGRPKIATGNAFEP
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtgctgatgttgtcgtgggagtacccacccgtggtcgtcggcggactcgcacgg
cacgtccacgccctggcccggcatctcgccaggcaggggcacgacgtggtcgtcctgtgc
cgtcacacggcgggcaccgacgccgagacccatccgaggaccgatcgcgtggtcgagggc
gtccggatcatccgggtcgccgaagacccgatgcacgtgaccttcgaacgggacctcgtc
gcgtggacgctggccatggggcacgcgatggtccgcgccgccaccgatctgctgcgcacg
tggcagccggacgtcgtgcacgcgcacgactggctggtcacccaccccgcgatcgcgatc
gcggaggccgcgcgggtgccgctggtcggcacgatccacgccaccgaggccggacggcac
tccggctggctctcgcatccgctgaaccagcaggtgcactccgtcgagtggtggctcgcg
aaccgctcggacgcgctgatcacctgttcgcaggccatgcgccgcgaggtggcgcatctg
ttcgaggtcgacgccgacgcggtcaccgtgatccacaacggcatcgaggagcgcacctgg
caggtgccggaggaggaggtcgcgcacgcgcgcgaggtctacagcccctccggcgcgccg
ctgctgctctacttcgggcggctggaatgggagaagggcgtgcaggacctgctcgccgcg
ctcccccggatccgccgggccaaaccggggacgcggctggtcgtcgccggcaaggggcgg
catctggaggaactggtcgaccaggcccgcaagctgcgtgtccggcgagcggtggacttc
gtcgggcacctgtccgaccgcgaactgcgcgccgtgctggccgcggccgacgccgtcgtg
ctgcccagccggtacgagccgttcgggatcgtcgcgctggaggccgccgccgcgaaggcg
ccactggtggcttcgaccgcgggcgggctcggcgaggtcgtcgtcgacggcgagaccggc
ctggcgttcagccccggcgatgtcgaggcgctcggggacgccgtcgaggcggtgctggac
gacgaggtcgccgccgcgcggcgggcgctgaccgcgcagtcgcggctggccgcggacttc
gactgggggcggatcgcggaggcgaccgtggccgtctaccggcgtgcccgcgtcggtgag
ccggtggagctggggcggccgaagatcgcgaccggcaacgccttcgagccctga

DBGET integrated database retrieval system