KEGG   Amycolatopsis orientalis: AORI_7422Help
Entry
AORI_7422         CDS       T02678                                 

Definition
(GenBank) alkaline phosphatase D
  KO
K01113  alkaline phosphatase D [EC:3.1.3.1]
Organism
aoi  Amycolatopsis orientalis
Pathway
aoi00790  Folate biosynthesis
aoi01100  Metabolic pathways
aoi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:aoi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AORI_7422
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AORI_7422
Enzymes [BR:aoi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     AORI_7422
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhoD PhoD_N Pur_ac_phosph_N
Motif
Other DBs
NCBI-ProteinID: AGM10004
UniProt: R4T334
Position
complement(8230298..8230879)
Genome map
AA seq 193 aa AA seqDB search
MAADAGFARVVARGHLRTGPERDHTVKVTAGGLRAATGYWYRFTSQGKVSQTGRTRTAPS
RDEDVESLRFGVVSCANWAVGHFAPYGYLSGRDDLDAFIHLGDYLYEGSPNPAGDLRPSV
PPNELITLADYRQRHAMYKTDEHLRRLHARHPMIATWDDHEVADNAWSGGSPSHHPATEG
DWAASRAGPRPGT
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
gtggccgccgatgccggcttcgcgcgcgtcgtcgctcgcggtcaccttcggaccgggccg
gaacgcgaccacacggtgaaggtgacggcgggcgggctgcgcgcggcgaccgggtattgg
taccggttcacgtctcaggggaaggtctcgcagaccggccggacccgcacggcgccttcg
cgcgacgaggacgtcgagagcctgcgcttcggcgtggtctcgtgtgcgaactgggctgtc
ggtcacttcgccccctacggctatctgtccggccgcgacgatctggacgccttcattcac
ctgggtgactacctctacgaagggagtcccaaccctgcgggtgatcttcggccttcggta
ccgcccaatgagttgatcaccctggcggattaccgacaacgtcacgcgatgtacaagacc
gacgagcacctgcggcggctgcacgcccgccacccgatgatcgcgacctgggacgaccac
gaggtcgccgacaacgcctggtccggcggatcgccgtcacaccacccggcgaccgagggt
gactgggcggcctcgcgcgcgggaccgcgtcctggaacctga

DBGET integrated database retrieval system