KEGG   Agromonas oligotrophica: S58_00810Help
Entry
S58_00810         CDS       T02484                                 

Definition
bifunctional mutM protein
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
aol  Agromonas oligotrophica
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:aol03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(86620..87501)
Genome map
AA seq 293 aa AA seqDB search
MPELPEVETVRRGLQPVMEGAKIVIAETRRGDLRFPFQPDFAKRLQGQTVTGLGRRAKYL
LADLGSGDVLLMHLGMSGSFRVIKPEHEETPGEFHYPRGKDSVHDHVVFHMSSGADIVFN
DPRRFGFMKIIARGDIEAEPHLRGLGPEPLGNEFDAGMLARACANKKTSLKAALLDQRVV
AGLGNIYVCEALFRAHLSPRRLAATLATKKGEPTDHARRLVEAIHTVLNEAIRAGGSSLR
DHRQTSGELGYFQHSFQVYDREGEPCRTDGCEGVVKRFVQNGRSTFWCPKCQK
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagctgcccgaagtcgagaccgtccggcgcgggttgcagccggtcatggagggg
gccaagatcgtcatcgccgagactcggcgcggcgatttgaggtttccgttccagcccgat
tttgcgaagcgcctgcagggccagaccgtcaccgggctcggtcggcgcgcgaaatatctg
ctggccgatctcggctccggcgacgtgctgctgatgcatctgggcatgtcaggctcgttc
cgggtgatcaagcctgagcacgaggagacgccaggcgagtttcactacccgcgcggcaag
gacagcgtgcacgaccatgtcgtgtttcacatgtcgtccggcgccgacatcgtgttcaac
gatccgcgccgcttcggcttcatgaagatcatcgcgcgcggcgacatcgaggccgagccg
catctcaggggcctcggacccgagccgctcggcaatgaattcgatgcagggatgctggcg
cgcgcctgcgccaacaagaagaccagcctgaaggcggcgctgctcgaccagcgcgtcgtc
gccggcctcggcaacatctatgtctgcgaggcgctgttccgcgcgcatctgtcgccgcga
cgtctggccgcgacgctggcgaccaaaaagggtgagcccacggatcatgccaggcggctg
gtggaggcgatccacaccgtgctcaacgaggccatccgcgccggcggctcgtcgttgcgc
gatcaccgccagacatcaggcgaactcggctattttcagcattcgtttcaggtctatgac
cgcgagggcgagccgtgccggacggatggctgcgagggcgtggtgaagcgcttcgtgcag
aacgggcggtcgaccttctggtgtccgaagtgccagaagtga

DBGET integrated database retrieval system