KEGG   Bradyrhizobium oligotrophicum: S58_07130Help
Entry
S58_07130         CDS       T02484                                 

Definition
ATP-dependent DNA ligase
Orthology
K10747  
DNA ligase 1 [EC:6.5.1.1]
Organism
aol  Bradyrhizobium oligotrophicum
Pathway
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Brite
KEGG Orthology (KO) [BR:aol00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    S58_07130
   03410 Base excision repair
    S58_07130
   03420 Nucleotide excision repair
    S58_07130
   03430 Mismatch repair
    S58_07130
Enzymes [BR:aol01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     S58_07130
DNA replication proteins [BR:aol03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (archaeal)
    Other elongation factors
     S58_07130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(786353..788221)
Genome map
AA seq 622 aa AA seqDB search
MNRFAELLDRLAYEPGRNNKLRLLTAYFREVEDPDRGYALGALTGALSFKHAKPALIRDL
IAARTDPVLFALSYDHVGDLSETVALMWPKGGAHQQQRVVGYPPPQPSPTRGEGAELRSE
LAPQSTSTASSMSVLVLPNTALSIPSPLVGEGQGGGYPTGGLTREPGHNNPPPPTLTEVV
TTLRTLGKTEMPRRLAKWLDELDETGRWALLKLVTGALRIGISARLAKTAAAALGDKDPH
EVELIWPGLSPPYLDLFAWLEGRGDKPVNRDPAPFRPVMLAHAVEDDDFASMNAADYVAE
WKWDGIRVQAVSGRDPEGHIVTRLYSRSGEDITGSFPDLLPSLHLPGALDGELLVVREGR
VQSFNVLQQRLNRKTVSPKLMKEYPIHLRAYDLLGDEDNDLRELPFAERRERLEAFIKRL
DDARVDLSPTISFSTWDELKAARADPASAGAGEDAEAVEGVMLKRRDALYLPGRPKGQWW
KWKHDPHIIDAVLMYAQRGHGKRSSYYSDYTFGVWTTGEAGDQLVPVGKAYFGFTDEELL
QIDRFVRRNTTEKFGPVRHVVHEPAQGLVLEVAFEGLQRSPRHKSGIAMRFPRISRLRWD
KPPRDADRLETLERMLKSETAG
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgcttcgccgagctgctcgaccgcctcgcctatgagcccggccgcaacaacaag
ctgcggctgctgacggcgtatttccgcgaggtcgaagatcccgatcgcggctacgcgctg
ggtgcgctgaccggcgcgctgtcgttcaagcacgccaagccggccctgatccgcgacctc
atcgccgcgcgcaccgatccggtgctgttcgcgctgtcatatgatcatgtcggcgatctc
tccgaaacggtcgcgctgatgtggccgaagggcggtgctcatcagcagcagcgcgtcgtg
gggtatccccctccccagccctcccccacaaggggggagggagccgagttgcgctcggag
ttggcacctcagtcgacatcgaccgcgagctcgatgagtgttctcgtccttccgaacacc
gctctctccattccctccccccttgtgggggagggtcagggaggggggtatcccacgggc
ggtctcacgagagagcccggccacaacaatccaccgccaccgacgctcaccgaggtcgtc
acgaccttgcgcacgctcggcaagaccgagatgccgcgacggctcgcgaaatggctggac
gagctcgacgagaccgggcgctgggcgttgctgaagctcgtcaccggcgctctgcgcatc
ggcatctccgcacgcctcgccaagaccgcggccgctgcgctcggcgacaaagacccgcat
gaggtcgagctgatctggcccggtttgtcgccgccctatctcgatctgttcgcctggctg
gagggccgcggcgacaagccggtgaaccgagacccggcgccgtttcgtcccgtcatgctg
gcgcatgccgtggaggacgacgacttcgccagcatgaacgcagccgactacgtcgccgag
tggaagtgggacggcattcgcgtgcaggcggtgagtggccgcgatcccgaaggccacatc
gtcacgcggctgtattcgcgcagcggcgaggacatcacaggaagcttcccggaccttttg
ccgtcactgcatctgccgggcgcgctcgacggcgagctgctggtcgtccgtgaggggcgc
gtgcagagcttcaacgtgctgcagcagcggctgaaccgcaagacggtgtcgccgaagctg
atgaaggagtatccgatccacctgcgcgcctacgacctgctcggcgacgaggacaatgat
ctgcgcgagctgccgttcgccgagcgccgcgagcggctggaagcgttcatcaagcgcctg
gacgatgccagggtcgacctgtcgccgacgatctccttctccacctgggacgagttgaaa
gccgcacgcgccgacccggcctcggccggcgcgggagaagacgccgaggcggtcgaaggc
gtgatgctgaagcggcgcgatgcgctgtatctgccgggccgtcccaagggacagtggtgg
aagtggaagcacgatccgcacatcatcgacgccgtgctgatgtatgcgcagcgcggccat
ggcaagcgctcgtcctattactcggactacacgttcggtgtctggactacaggtgaggcc
ggcgaccagctcgtgcccgtcggcaaggcctatttcggcttcaccgacgaggagctctta
cagatcgaccgcttcgtccgccgcaacaccaccgagaagttcggccccgtgcgccatgtc
gtgcatgagcccgcgcaggggctggtgctggaggtcgcattcgaggggctgcaaagatcg
ccgcggcacaaatccggtatcgcgatgcgcttcccgcgcatcagccggctgcgctgggac
aagccgccgcgcgacgccgaccggctggagacgctggagcggatgctgaagagcgagacg
gcggggtga

DBGET integrated database retrieval system