KEGG   Agromonas oligotrophica: S58_08170Help
Entry
S58_08170         CDS       T02484                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
aol  Agromonas oligotrophica
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:aol01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:aol00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
896458..897753
Genome map
AA seq 431 aa AA seqDB search
MPIRLSRASTDFDTQFRQFLAAKRETSADVEAAARAIVDDVAKRGDAALLEATRKFDRLE
LTASSLRVTPAEIEAAVKVCDAATVDALKFARDRIEAFHLRQLPQDQRFTDEAGVELGWR
WSAIESAGLYVPGGTAAYPSSVLMNAIPAKVAGVGRLVMVVPSPDGRLNPLVLAAAHLGG
VSEIYRVGGAQAVAALAHGTATIAPVAKIVGPGNAYVAAAKRLVFGKVGIDMIAGPSEVL
VIADDSGNADWIAADLLAQAEHDASAQSILITDSRRLADDVARAVEGQLKTLPRAGIAGA
SWADFGAIIEVDRLDQAVPLADAIAAEHLEIMTADPDAFAARVRNAGAIFLGAHTPEAIG
DYVGGSNHVLPTARSARFSSGLGVLDFMKRTSLLKCGPDQLRALGPAAMTLGRAEGLEAH
SRSVGIRLNLP
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgcccattcgcctgtcccgcgccagcaccgatttcgacacccagtttcggcagtttctc
gccgccaagcgcgagacctccgccgacgtcgaagccgccgcccgcgccatcgtcgacgat
gtcgccaaacgcggtgatgcggcgctgctcgaggcgacgcgcaagttcgaccggctggag
ctgactgcgtcgtcgctgcgcgtcacgcccgccgagatcgaggccgccgtgaaggtctgc
gacgccgcaacggtcgatgcgctgaaattcgcccgcgaccgcatcgaggcgtttcatctc
aggcagctgccgcaggaccagcgcttcaccgacgaagccggcgtcgagctcggttggcgc
tggagcgcgatcgagtcggccggcctctatgtgcccggcggcaccgcggcctatccgtcg
tcggtgctgatgaatgccatccccgccaaggtcgcgggcgtcgggcgtctggtgatggtg
gtgccgtcgccggacggcaggctcaacccgctggtgctggccgccgcccatctcggcggc
gtctccgagatctaccgcgtcggcggcgcccaggccgtagcggcgctggcgcatggcacc
gcgacgatcgcgccggtcgccaagatcgtcgggcccggaaatgcctatgtcgccgccgcc
aagcggctggtgttcggcaaggtcggcatcgacatgatcgccggcccctccgaggtgctg
gtcatcgccgacgacagcggcaatgccgactggatcgcggccgacctcctggcccaggcc
gagcatgacgccagcgcccagtcgatcctgatcaccgacagccgccgcctggcggacgac
gtcgcccgcgccgtcgagggccagctcaagaccttgccgcgcgccgggatcgccggcgcc
tcctgggccgatttcggcgccatcatcgaagtcgaccgcctcgaccaggccgtgccgctg
gcggacgccatcgcggccgagcatctggagatcatgactgccgatcccgacgcgttcgcg
gcccgggtgcgcaatgcgggcgccatcttcctgggcgcgcacacgccggaggcgatcggc
gactatgtcggcggctccaatcacgtgctgccgaccgcgcgctcggcgcggttctcctcg
gggctcggcgtgctcgacttcatgaagcgcacgtcgctgttgaaatgcggtccggaccag
ttgcgcgcgctgggtccagcggcgatgactctggggcgggccgagggcctcgaggcccat
tcgcgctccgtgggaatacgcctcaacctgccatga

DBGET integrated database retrieval system