KEGG   Bradyrhizobium oligotrophicum: S58_08170Help
Entry
S58_08170         CDS       T02484                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
aol  Bradyrhizobium oligotrophicum
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aol00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    S58_08170
  Amino acid metabolism
   00340 Histidine metabolism
    S58_08170
Enzymes [BR:aol01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     S58_08170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
896458..897753
Genome map
AA seq 431 aa AA seqDB search
MPIRLSRASTDFDTQFRQFLAAKRETSADVEAAARAIVDDVAKRGDAALLEATRKFDRLE
LTASSLRVTPAEIEAAVKVCDAATVDALKFARDRIEAFHLRQLPQDQRFTDEAGVELGWR
WSAIESAGLYVPGGTAAYPSSVLMNAIPAKVAGVGRLVMVVPSPDGRLNPLVLAAAHLGG
VSEIYRVGGAQAVAALAHGTATIAPVAKIVGPGNAYVAAAKRLVFGKVGIDMIAGPSEVL
VIADDSGNADWIAADLLAQAEHDASAQSILITDSRRLADDVARAVEGQLKTLPRAGIAGA
SWADFGAIIEVDRLDQAVPLADAIAAEHLEIMTADPDAFAARVRNAGAIFLGAHTPEAIG
DYVGGSNHVLPTARSARFSSGLGVLDFMKRTSLLKCGPDQLRALGPAAMTLGRAEGLEAH
SRSVGIRLNLP
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgcccattcgcctgtcccgcgccagcaccgatttcgacacccagtttcggcagtttctc
gccgccaagcgcgagacctccgccgacgtcgaagccgccgcccgcgccatcgtcgacgat
gtcgccaaacgcggtgatgcggcgctgctcgaggcgacgcgcaagttcgaccggctggag
ctgactgcgtcgtcgctgcgcgtcacgcccgccgagatcgaggccgccgtgaaggtctgc
gacgccgcaacggtcgatgcgctgaaattcgcccgcgaccgcatcgaggcgtttcatctc
aggcagctgccgcaggaccagcgcttcaccgacgaagccggcgtcgagctcggttggcgc
tggagcgcgatcgagtcggccggcctctatgtgcccggcggcaccgcggcctatccgtcg
tcggtgctgatgaatgccatccccgccaaggtcgcgggcgtcgggcgtctggtgatggtg
gtgccgtcgccggacggcaggctcaacccgctggtgctggccgccgcccatctcggcggc
gtctccgagatctaccgcgtcggcggcgcccaggccgtagcggcgctggcgcatggcacc
gcgacgatcgcgccggtcgccaagatcgtcgggcccggaaatgcctatgtcgccgccgcc
aagcggctggtgttcggcaaggtcggcatcgacatgatcgccggcccctccgaggtgctg
gtcatcgccgacgacagcggcaatgccgactggatcgcggccgacctcctggcccaggcc
gagcatgacgccagcgcccagtcgatcctgatcaccgacagccgccgcctggcggacgac
gtcgcccgcgccgtcgagggccagctcaagaccttgccgcgcgccgggatcgccggcgcc
tcctgggccgatttcggcgccatcatcgaagtcgaccgcctcgaccaggccgtgccgctg
gcggacgccatcgcggccgagcatctggagatcatgactgccgatcccgacgcgttcgcg
gcccgggtgcgcaatgcgggcgccatcttcctgggcgcgcacacgccggaggcgatcggc
gactatgtcggcggctccaatcacgtgctgccgaccgcgcgctcggcgcggttctcctcg
gggctcggcgtgctcgacttcatgaagcgcacgtcgctgttgaaatgcggtccggaccag
ttgcgcgcgctgggtccagcggcgatgactctggggcgggccgagggcctcgaggcccat
tcgcgctccgtgggaatacgcctcaacctgccatga

DBGET integrated database retrieval system