KEGG   Bradyrhizobium oligotrophicum: S58_18040Help
Entry
S58_18040         CDS       T02484                                 

Definition
putative 4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
aol  Bradyrhizobium oligotrophicum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aol00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    S58_18040
Enzymes [BR:aol01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     S58_18040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2073099..2075051
Genome map
AA seq 650 aa AA seqDB search
MDLYKEAQYLGILTEFYDGQGQRRVTDEAALKIIVEAFPRPTPHRLLSGAIVIRSGQPVR
SRLSEAAQLPVVWTIKRGDVQVASGEAGEALVEWPADLPVGSYRLELVDASSCREDLPLL
VAPEKAFGGDFDRGWLLAVQLYGIRSGRNWGMGDFTDLANLIELGAKLGADGVGLNPLHA
LFDDRPGDFSPYAPNSRLFLNALYVDVEQAPGFRKGPDSKVLKELRQAEFVDYKGVAALK
WPALRAAFKAFMAMPDSAEAAEFKTYRAERGDLLARFTCFEVLRHRFQQPWWEWPAEWRE
PDAARCAALLNGPDRREADFVAYVQWLAERQLRHCKELAHRLGMKVGLYLDVAVGVQSDG
FDAWNEQGAISRTLSVGAPPDPLNTVGQNWGLAGFNAPGLELKNFEPFREMVRASMRHAG
AIRLDHVLGLKRLYLVPHGFPAKQGAYVQMPFDALLAATALESAANECIVIGEDLGTVPE
GFREQMADWGLWSYKVMIFERDDNARFRDVDAYPPNALVTLNTHDLSTYAGWRSFGDLTT
KRGLDIDPGETDEERWRALGLWDEVLRHNAIERNDVYSAISFLSRTRSRLLAISLEDLLG
VVDQPNIPGTIDEHPNWQRKMPVAIEDITGAIDAEALKVATAERISPAGV
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atggatctctacaaagaagctcaatatctcggaattctgaccgaattctatgacggtcag
gggcagcgccgcgtcaccgacgaggcagccctcaagatcatcgtcgaggccttcccgagg
cccacaccgcaccggctgctcagcggcgccatcgtgattcgatccgggcagcccgtccgc
agtcggctcagcgaggcggcccagctgccggtcgtatggaccatcaagcggggggacgta
caggttgccagcggcgaggccggcgaggcgctggtcgaatggccagccgatcttccggtg
ggcagctatcgcctcgagctcgtggacgcgtcgtcatgccgcgaggatctgccactgctg
gtcgcgccggagaaggcgttcggcggcgatttcgaccgcggctggctgctggcggtgcag
ctctacggcattcgctcgggccgcaactggggtatgggcgattttaccgatctggccaat
ctgatcgagctcggtgccaagctcggcgccgacggcgtcggtctcaatccgctgcatgcg
ctgttcgatgaccggcccggggatttcagcccctatgcgccgaacagtcggctgttcctg
aatgcactctatgtcgatgtcgaacaagcgccgggcttccggaaggggcccgacagcaag
gtgctcaaggagctgaggcaagccgagttcgtcgattacaagggcgttgcggcgctgaaa
tggccggcgctgcgcgcggccttcaaggccttcatggcgatgccggacagcgccgaggcc
gccgagttcaagacctatcgcgccgagcgtggcgacctgctcgcgcgcttcacctgcttc
gaagtgctgcggcatcgcttccagcagccatggtgggaatggcccgcggaatggcgcgag
ccggacgcggcgcgctgtgcggctctgctcaacggtcccgatcgccgtgaggccgatttc
gtcgcttatgtgcagtggctcgccgagcggcagctgcgccattgcaaggagctcgcccat
cggctcggcatgaaggtgggtctctatctggacgttgcggtcggtgttcaatccgacggc
ttcgacgcctggaacgagcagggagcgatttcgcggacgctgtccgtcggcgcgccgccc
gatcccttgaatacggttggacagaactggggtctggccggcttcaatgcaccggggctc
gaattgaagaatttcgaaccgttccgggagatggtgcgggcgtcgatgcgtcatgccggg
gcgatccggctcgatcacgtgctcggtctgaagcggctctatctcgtgccgcacggcttt
cccgccaagcagggcgcctatgtccagatgcctttcgacgctctcctggcggccaccgcc
ctggagagcgccgcaaacgagtgtatcgtcatcggcgaggatctcggcaccgtgccggaa
ggttttcgcgagcagatggccgattgggggctgtggtcgtacaaggtgatgatcttcgag
cgcgacgacaacgcgcgcttccgcgatgtcgatgcttatccgccgaacgccttggtgacg
ctcaatacgcacgatctctcgacctatgccggctggcgttcgttcggcgatctcacgaca
aagcgcggtctcgacatcgatcccggcgagaccgacgaggagcgctggcgcgcattgggg
ctgtgggacgaggtgctgcgtcacaacgcgatcgaacgcaacgacgtctattcggcgatc
agcttcctgtcgcgaacgcggtcacggctgctcgcgatttcgctggaagacctgctcggc
gtggtcgaccaaccgaacattccgggcacgatcgacgagcatccgaactggcagcgcaag
atgccggtcgcgatcgaagacatcaccggtgcgatcgatgccgaggcgctgaaagtcgca
actgccgaacggatcagtccggcgggcgtttga

  All links  
No link information was found.   
DBGET integrated database retrieval system