KEGG   Bradyrhizobium oligotrophicum: S58_23780Help
Entry
S58_23780         CDS       T02484                                 

Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
aol  Bradyrhizobium oligotrophicum
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:aol00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    S58_23780
  Amino acid metabolism
   00330 Arginine and proline metabolism
    S58_23780
Enzymes [BR:aol01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     S58_23780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2679487..2680461
Genome map
AA seq 324 aa AA seqDB search
MASSDPTPPHRIAVLGAPIDLGASVRGTLMGPAALRTAGLITVLESLGLDVTDYGDVGFA
DIAELGDEPPANAKHYRQIQRWSRVLARRSHELAQTGAIPVFLGGDHSLSMGSVNGIARH
CREIGRDLFVLWLDAHADYNTPETTITANMHGMSAAFLCGEPGLDGLLGDERRASIPPVQ
LELFGIRSIDKAEKELLRRRSVSIADMRAIDEFGVGVLMRRVLDKVRARNGVLHVSFDVD
FLDPEVAPGVGTTVPGGATYREAHLIMEMLHDSGLVRSVDIVELNPFLDERGKTARVAVE
LIASLFGQQITDRPTPTNAIVPDQ
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
gtggcttcatcggacccgacaccgccgcaccgcatcgccgtcctcggcgcgccgatcgac
ctcggcgcctccgtgcgcggcacgctgatgggtcccgcggcgctgcgcaccgcgggactg
atcaccgtgctcgaaagcctcgggcttgacgtgaccgactatggcgatgtcggctttgcc
gatatcgccgagctcggcgatgagcctcccgccaatgccaagcactatcgccagatccag
cgctggtcccgggtgctcgcgcgtcgcagccatgaactggcgcagaccggagcgatcccg
gtgttcctgggcggcgaccattcgctgtcgatgggatcggtaaatgggattgcgcgccat
tgccgtgagatcggacgggacttgttcgtgctctggcttgatgcgcatgccgactacaac
acgccggagacgacgatcaccgccaacatgcacggcatgtcggctgccttcctgtgcggc
gagccgggcctcgatggcctgcttggcgacgaacggcgcgcctccatcccgccggtgcaa
ttggagctgttcgggatccggtcgatcgacaaggccgagaaggagctgttgcgccggcga
agcgtcagcattgccgacatgcgtgcgatcgacgagttcggcgtcggcgtcttgatgcgc
cgggttctcgacaaggtccgcgcgcgaaatggcgtgctgcatgtcagcttcgacgtcgac
ttcctcgatcccgaggtggcgccgggcgtcggcaccaccgttccaggcggcgcgacctat
cgcgaggcacatctcatcatggagatgctgcacgattccggtctggtgcggtcggtcgat
atcgtggagctcaatcccttcctcgacgagcgcggcaagacggcgcgcgtcgcggtcgaa
ctcatcgccagcctgttcggccagcagatcaccgatcggccgacgccgaccaatgcgatc
gtcccggatcaatag

DBGET integrated database retrieval system