KEGG   Bradyrhizobium oligotrophicum: S58_28510Help
Entry
S58_28510         CDS       T02484                                 

Definition
putative dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
aol  Bradyrhizobium oligotrophicum
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aol00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    S58_28510
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    S58_28510
Enzymes [BR:aol01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     S58_28510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3206701..3207243
Genome map
AA seq 180 aa AA seqDB search
MRFVQLGRSDARLIELTVRADERGSFTRTWCAKTFADEGIDFQPVQGNSSVTRISGSVRG
MHFQRAPKPDAKIVRCSAGLIHDVIVDIRPNSPTRGEIYACELGPTTARMLYIPAGFAHG
FQALTDDVTVEYLMGIEYVEDLSDGFRHDDPMIGIKWPQPVTVLSAKDAAWPLLAERGLW
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgaggtttgtccagctgggacggtcggatgcgcggctgatcgagctcacggtccgcgcc
gacgagcgtggcagcttcacgcggacctggtgtgcgaagaccttcgctgacgagggcatc
gacttccagccggttcagggcaatagctcggtgacccgtatcagcggaagcgtgcgcggc
atgcattttcagcgcgcgccgaagcccgacgccaagatcgtgcgctgctccgccggactc
atccatgacgtcatcgtcgatatcaggccgaattcgccgacgcggggcgagatctatgcc
tgtgagctcgggccgaccacagcgcggatgctctacattcccgcaggctttgcccacggc
ttccaggcgctcaccgacgacgtgacggtcgagtacctgatgggcatcgaatatgtcgag
gatctgtcggatggtttccgccacgatgatccgatgatcgggatcaagtggccgcagccc
gtgaccgtcctgtcggcgaaggatgccgcctggccattgcttgcagaacgaggtctgtgg
tga

DBGET integrated database retrieval system