KEGG   Agromonas oligotrophica: S58_28810Help
Entry
S58_28810         CDS       T02484                                 

Definition
L-fuculose phosphate aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
aol  Agromonas oligotrophica
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:aol00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3245580..3246338
Genome map
AA seq 252 aa AA seqDB search
MNREERLLRENIIAKCRWMNASGLNQGTSGNISARYKDRMLITPSATPYDLMKPDMIASM
PLEGDYGSWDGPLKPSTEWRFHLDIMRGRADVGGVVHTHSTYATVLAIARKSIPACHYMM
AAFGGNDVRCAGYARYGTAELSELALAALEGRNGCLLANHGMIAVGANLDKAMWLAVELE
TIAKQYYLSLALGQPHILGDAEIAETAQGFSTYGLQEPKAKATKSAKPVKAATKTRAAAE
RRKPEKKRSIKR
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgcgaggaacgactgctccgcgaaaacatcatcgccaaatgccggtggatgaac
gcgtcgggcctgaaccagggcacctcgggcaacatctccgcccgctacaaggatcgcatg
ctgatcacgccgtcggccacgccctatgacttgatgaagccggacatgatcgcctcgatg
ccgctcgagggcgactacggatcctgggacgggccgctgaagccctcgacggaatggcgc
tttcatctcgacatcatgcgcgggcgcgccgatgtcggtggtgtcgtgcacacccactcg
acctacgccaccgtgcttgcgatcgcgcgcaagtcgatcccggcctgccactacatgatg
gcagcgttcggcggcaatgacgtccgctgcgccggctatgcgcgctacggcacagcggag
ctgtcggagctcgcgctcgccgcgctcgagggtcgcaacggctgcctgctcgccaatcat
ggcatgatcgcggtgggtgccaatctcgacaaggcgatgtggctcgcggtcgagctcgag
accattgcgaagcagtactatctgtcgctcgcgctcggccagccgcacatcctcggtgac
gccgagatcgccgagacggcgcagggcttttcgacttacgggctgcaggagcccaaagcg
aaggcgaccaagtcggccaagcctgtcaaggcggcaacgaagacgcgtgccgccgccgag
cgtcgcaagcctgagaagaagcgcagcatcaagcgatga

DBGET integrated database retrieval system