KEGG   Agromonas oligotrophica: S58_37980Help
Entry
S58_37980         CDS       T02484                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
aol  Agromonas oligotrophica
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:aol01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:aol00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4315285..4316922
Genome map
AA seq 545 aa AA seqDB search
MNFQPRGLNDQALQGPSSYQAEVEAARALLETNPTWNGVTAEAVARMRLQNRFKTGLDVA
RYTASVMRADMAAYDEDSTKYTQSLGCWHGFIAQQKLISIKKHFGKTDRRYLYLSGWMIA
ALRSEFGPLPDQSMHEKTSVPALIEELYTFLRQADSRELNDIFRSLDAARKAGDKAKEAD
IIAKIDGFQTHVVPVIADIDAGFGNAEATYLLAKKMIEAGACALQIENQVSDEKQCGHQD
GKVTVPHDVFLAKIRACRHAFLELGVEDGIVVTRTDSLGAGLTQQIAFSSQPGDLGDQYN
SFLDCEEVTPATARSGDVIINQNGKMMRPKRLPSNLYQFRPGTGEDRCVLDCITSLQNGA
DLLWIETEKPHIEQIAKMVDRIRKVIPNAKLAYNNSPSFNWTLNFRWQVYDAMKEAGKDV
SKYNRAELMKAEYDDTPLAKEADERIRTFQADSAKRAGIFHHLITLPTYHTAALSTDNLA
REYFGEQGMLGYVKNVQRAEIRQGIACVRHQNMAGSDIGDDHKEYFAGEKALKAGGAHNT
MNQFG
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgaacttccaaccgcgtggactgaacgaccaggctctccagggaccctcgtcctaccag
gccgaggtcgaggcggcgcgtgcgctgctcgagaccaacccgacctggaacggcgtcacc
gccgaggccgtggcgcgcatgcgcctgcagaaccgcttcaagaccggtctcgacgttgcc
cgctacaccgcgtccgtgatgcgcgccgacatggccgcctatgatgaggacagcaccaag
tacacccagtcgctgggctgctggcacggcttcatcgcgcagcagaagctgatctcgatc
aagaagcatttcggcaagaccgaccgccgctacctctatctctccggctggatgatcgcg
gcgctgcgctccgagttcggcccgctgccggaccagtcgatgcacgagaagacctcggtg
cccgcgctgatcgaggagctctacaccttcctgcgccaggctgattcccgcgagctcaac
gacatcttccgcagcctcgacgcggcccgcaaggccggcgacaaggcgaaggaagccgac
atcattgccaagatcgacggcttccagactcacgtcgttcctgtcatcgccgacatcgac
gccggcttcggcaatgccgaggcgacctatctgctcgccaagaagatgatcgaggcgggc
gcctgcgcgctgcagatcgagaaccaggtctccgacgagaagcagtgcggccatcaggac
ggcaaggtcaccgtgccgcatgacgtcttcctggccaagatccgcgcctgccgccacgcc
ttcctggagctcggcgtcgaggacggcatcgtcgtcacccgcaccgactcgctcggcgcc
ggcctgacgcagcagatcgccttctccagccagccgggcgatctcggcgaccagtacaac
agcttcctcgactgcgaggaagtgacgcctgcgaccgcgcgcagcggcgacgtcatcatc
aaccagaacggcaagatgatgcgtccgaagcggctgccctcgaacctctaccagttccgt
cccggcaccggtgaggaccgctgcgtgctcgactgcatcacctcgctgcagaacggcgct
gacctgctgtggatcgagaccgagaagccgcatatcgagcagatcgccaagatggtcgac
cgcatccgcaaggtgatcccgaacgccaagctcgcctacaacaactcgccgtcgttcaac
tggaccctcaacttccgttggcaggtctatgatgcgatgaaggaagcgggcaaggacgtc
agcaagtacaaccgcgccgaactgatgaaggcggagtatgacgacaccccgctggcgaag
gaagccgacgagcgcatccgcaccttccaggcggactcggccaagcgcgccggcatcttc
caccacctgatcacgctgccgacctaccacacggccgcgctgtcgaccgacaacctcgcc
cgcgagtatttcggcgagcagggcatgctgggctacgtcaagaacgtccagcgcgccgag
atccgccagggcatcgcctgcgtccgccaccagaacatggccggctccgacatcggcgac
gaccacaaggaatattttgcgggcgagaaggcgctgaaggccggcggcgcgcacaacacg
atgaatcagttcggctga

DBGET integrated database retrieval system