KEGG   Bradyrhizobium oligotrophicum: S58_37980Help
Entry
S58_37980         CDS       T02484                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
aol  Bradyrhizobium oligotrophicum
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:aol00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    S58_37980
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    S58_37980
Enzymes [BR:aol01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     S58_37980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4315285..4316922
Genome map
AA seq 545 aa AA seqDB search
MNFQPRGLNDQALQGPSSYQAEVEAARALLETNPTWNGVTAEAVARMRLQNRFKTGLDVA
RYTASVMRADMAAYDEDSTKYTQSLGCWHGFIAQQKLISIKKHFGKTDRRYLYLSGWMIA
ALRSEFGPLPDQSMHEKTSVPALIEELYTFLRQADSRELNDIFRSLDAARKAGDKAKEAD
IIAKIDGFQTHVVPVIADIDAGFGNAEATYLLAKKMIEAGACALQIENQVSDEKQCGHQD
GKVTVPHDVFLAKIRACRHAFLELGVEDGIVVTRTDSLGAGLTQQIAFSSQPGDLGDQYN
SFLDCEEVTPATARSGDVIINQNGKMMRPKRLPSNLYQFRPGTGEDRCVLDCITSLQNGA
DLLWIETEKPHIEQIAKMVDRIRKVIPNAKLAYNNSPSFNWTLNFRWQVYDAMKEAGKDV
SKYNRAELMKAEYDDTPLAKEADERIRTFQADSAKRAGIFHHLITLPTYHTAALSTDNLA
REYFGEQGMLGYVKNVQRAEIRQGIACVRHQNMAGSDIGDDHKEYFAGEKALKAGGAHNT
MNQFG
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgaacttccaaccgcgtggactgaacgaccaggctctccagggaccctcgtcctaccag
gccgaggtcgaggcggcgcgtgcgctgctcgagaccaacccgacctggaacggcgtcacc
gccgaggccgtggcgcgcatgcgcctgcagaaccgcttcaagaccggtctcgacgttgcc
cgctacaccgcgtccgtgatgcgcgccgacatggccgcctatgatgaggacagcaccaag
tacacccagtcgctgggctgctggcacggcttcatcgcgcagcagaagctgatctcgatc
aagaagcatttcggcaagaccgaccgccgctacctctatctctccggctggatgatcgcg
gcgctgcgctccgagttcggcccgctgccggaccagtcgatgcacgagaagacctcggtg
cccgcgctgatcgaggagctctacaccttcctgcgccaggctgattcccgcgagctcaac
gacatcttccgcagcctcgacgcggcccgcaaggccggcgacaaggcgaaggaagccgac
atcattgccaagatcgacggcttccagactcacgtcgttcctgtcatcgccgacatcgac
gccggcttcggcaatgccgaggcgacctatctgctcgccaagaagatgatcgaggcgggc
gcctgcgcgctgcagatcgagaaccaggtctccgacgagaagcagtgcggccatcaggac
ggcaaggtcaccgtgccgcatgacgtcttcctggccaagatccgcgcctgccgccacgcc
ttcctggagctcggcgtcgaggacggcatcgtcgtcacccgcaccgactcgctcggcgcc
ggcctgacgcagcagatcgccttctccagccagccgggcgatctcggcgaccagtacaac
agcttcctcgactgcgaggaagtgacgcctgcgaccgcgcgcagcggcgacgtcatcatc
aaccagaacggcaagatgatgcgtccgaagcggctgccctcgaacctctaccagttccgt
cccggcaccggtgaggaccgctgcgtgctcgactgcatcacctcgctgcagaacggcgct
gacctgctgtggatcgagaccgagaagccgcatatcgagcagatcgccaagatggtcgac
cgcatccgcaaggtgatcccgaacgccaagctcgcctacaacaactcgccgtcgttcaac
tggaccctcaacttccgttggcaggtctatgatgcgatgaaggaagcgggcaaggacgtc
agcaagtacaaccgcgccgaactgatgaaggcggagtatgacgacaccccgctggcgaag
gaagccgacgagcgcatccgcaccttccaggcggactcggccaagcgcgccggcatcttc
caccacctgatcacgctgccgacctaccacacggccgcgctgtcgaccgacaacctcgcc
cgcgagtatttcggcgagcagggcatgctgggctacgtcaagaacgtccagcgcgccgag
atccgccagggcatcgcctgcgtccgccaccagaacatggccggctccgacatcggcgac
gaccacaaggaatattttgcgggcgagaaggcgctgaaggccggcggcgcgcacaacacg
atgaatcagttcggctga

DBGET integrated database retrieval system