KEGG   Bradyrhizobium oligotrophicum: S58_44890Help
Entry
S58_44890         CDS       T02484                                 

Definition
(RefSeq) putative glutaminase
  KO
K01425  
glutaminase [EC:3.5.1.2]
Organism
aol  Bradyrhizobium oligotrophicum
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aol00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    S58_44890
   00220 Arginine biosynthesis
    S58_44890
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    S58_44890
Enzymes [BR:aol01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     S58_44890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5097497..5099359
Genome map
AA seq 620 aa AA seqDB search
MTTEQPKPIRHPQHWATAAMPPLQRFLAGCHAEFWPDHDGAVANYIPELGKADPAHFGIS
LATLDGHVYEVGDSRVPFTIQSMSKPFVFAIALDALGSDQVERVIGVEPSGDPFNSIRLN
AENHPFNPMVNAGAIACSGLVRQARHGDAFETIRDALGRFAGRRLDVDDAVFTSEAATGD
RNRAIAYLLRTSDVLKEPVDDVLAVYFRQCAVLVTARDCAIMAATLANRGVNPVTGEQVV
TPYAVSRTLAVMTSSGMYDFAGEWIYRVGIPAKSGVGGGILASLPARLGLGSYSPRLDGH
GNSVRGIKVCEALSAHYGLHMLNRSDDARTSIIADYDIGANPSRRSRRAQERDILAAHPD
AVRVLELVGTLSFSNVDYVSRQLAGSARPQFVIFDLHRVTAMTQAGLRLLAELFRELADF
HVTVVLSGIRRSSAEWQEITERTGDLGNVRDFYLLDTAIEWAEDQIVYRYGGAIDFIETT
ELAEQPLLAGLSGDERHELAALATIKHYQQGERILAAGEPANSLFFLRSGVIHVTLPDGI
RLATLTAGQCFGEMALLEPLRSADVVADFSATAFEITLDDFERFRARHPKAGERIMRNLA
QLLAERLTIANARLNLLAAD
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccgaacagccgaagccgatccgccatccgcagcattgggccacggccgcgatg
ccgccgctgcagcgctttctcgctggctgccatgccgagttctggccggatcatgacggc
gcggtcgccaactacattccggagctcggcaaggccgatccggcgcatttcggcatcagc
ctcgccaccctcgacggccatgtctacgaggtcggtgacagccgcgtgccgttcacgatc
cagtcgatgtcgaagccgttcgtgttcgcgatcgcgctcgatgcgctcggctccgaccag
gttgaacgcgtgatcggcgtcgagccgtccggcgatcccttcaactccatccggctcaat
gccgagaaccatccgttcaatcccatggtcaatgccggcgcgatcgcctgcagcggcctg
gtccgccaggcccggcacggcgacgcgttcgagaccattcgcgatgcgctcggccgcttc
gcgggccgcaggctcgacgtcgacgatgcggtgttcacctcggaggccgcgaccggcgac
cgcaaccgcgcgatcgcctatctcttgagaacgtccgacgtgctcaaggagcccgtcgac
gacgtgctcgcggtctatttccggcaatgcgccgtgctggtcaccgcgcgcgactgcgcg
atcatggcggcgacgctggccaatcgcggcgtcaatccggtcaccggcgagcaggtcgtc
acgccctatgcggtgtcgcgcacgctcgcggtcatgacgtcgtccggcatgtatgacttc
gccggcgaatggatctaccgcgtcggcatccccgccaagagcggcgtcggcggcggcatc
ctggcgagcctgccggcgcggctcgggctcggcagctactcgccgcggctcgacggccac
ggcaacagcgtgcgcggcatcaaggtctgcgaggcgctgtcggcgcattacggcctgcac
atgctgaaccgctccgacgacgcccgcacctcgatcatcgccgactacgacatcggcgcc
aacccatcgcgccgcagccgccgcgcgcaggagcgcgacatcctcgccgcccatcccgac
gcggtgcgcgtgctcgaactggtcggaacactgtccttctcgaatgtcgactacgtctcg
cggcagctcgcgggcagcgcacgcccgcaattcgtcatcttcgatctccaccgcgtcacg
gcgatgacacaagccggcttgcgcctgctcgccgaactgtttcgcgagctcgccgacttc
cacgtcaccgtggtgctgtccggcatccggcgctcgtctgcggaatggcaggagatcacc
gagcggaccggcgacctcgggaacgtgcgcgacttctatctgctcgataccgcgatcgaa
tgggccgaagaccagatcgtctaccgctacggcggcgcgatcgacttcatcgaaaccacc
gagctcgccgagcagccgctgctcgcagggctttccggggacgaacgccacgaactcgcg
gcgctcgcgacgatcaaacattatcagcagggcgagcgcatcctcgccgccggcgagccg
gcgaactcgctgttcttcctgcgctccggcgtcatccacgtcaccctgcccgatggtatc
aggctggccacgctgacggccgggcagtgcttcggcgagatggcgctgttggagcccttg
cgctccgccgatgttgtcgccgacttctcggccacggcattcgaaatcacgctggacgat
ttcgagcgcttccgcgcgcgacatccgaaggcgggcgagcgcatcatgcgcaatctggcg
caacttctggccgagcgcctgaccatcgcgaatgcgcggctcaacctgctcgcggcagac
tga

DBGET integrated database retrieval system