KEGG   Agromonas oligotrophica: S58_45770Help
Entry
S58_45770         CDS       T02484                                 

Definition
putative 1,4-alpha-glucan branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
aol  Agromonas oligotrophica
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:aol00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5184643..5186604)
Genome map
AA seq 653 aa AA seqDB search
MDMLLEPVTLPPFPEGLRISLRQMHLLQAPMGGTLVTGGATFRVFAPHATAIYVSGPFND
WAQDASCRLAPIGNGHWAIFVPSLKDGDAYMYFVEGEGTSGYKRDPHARLLTVDPPFPQS
HAVLRNPQAFPWHDIDFTPPPYNELVIYQLHVGTFDMKAGNPDGCFFDVIERVPHLARLG
INAIELLPVQEFPSMFSMGYNGTDLFSPETDYGEAEEAHLAAYVARTNEILTAAGAAPYA
GVETLRHCDDQLRALIDVCHVHGIAVLFDVVYNHAGGGFDENSIWFFDRQSYGDPNRSLY
FTDQGRAGGQVFAYWNADVRQYLVDNAIMFYREYHADGLRFDEVSVMDHFGGWATCQQLT
EALRAEKPDAIQIAEYWPVNPWVVKDIAIGGAGFDATWSDALRLAVRGAIASAAGGAGAV
VPMQPIAAAIADLSLDKRWRAVNSIENHDIVYAGREPRIPRLADPLDSRCWYARSRSRVA
TSLLLTAPGIPMLFMGQELFEDRPWSDTPNPDTTIHWALLDGEDKITADATRFTRELIAI
RRTHPALTAEGCAIVHVHDGNRVLAFHRWDGQGDDVVVIVSLSETPWHDYAIGFPAVGTW
HEVFNSDVYDNWVNPGVVGNNGAVTAGGPALHGQPCSADVTIPANGVLVFARG
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atggatatgctgctcgaacctgttacgctgccgccattccccgaaggcctcaggatctca
ctcaggcagatgcatcttctccaggctcccatgggcggcaccctggtgaccggcggcgcc
acgttccgcgtgttcgcgccgcacgcgaccgccatctacgtctccggcccgttcaacgac
tgggcgcaggatgcgagctgccgtctcgcgccgatcggcaacggccattgggcgatcttc
gtgccgtccctcaaggacggcgacgcctatatgtatttcgtcgagggcgagggcacctcc
ggctacaagcgcgatccgcatgcgcggctgctcacggtcgatccgccgttcccgcaatcg
catgcggtgctgcgcaacccccaggcgtttccctggcacgacatcgacttcacgccgccg
ccttacaacgagctcgtgatctatcagctccatgtcggcaccttcgacatgaaggccggc
aatccagacggctgcttcttcgacgtcatcgagcgcgtgccgcatctggccaggctcggc
atcaacgccatcgagctgctgccggtgcaggaattcccgtcgatgttcagcatgggctac
aacggcaccgacctgttcagcccggagacggattatggcgaggcggaagaggcgcatctt
gcagcctatgtcgcgcgcaccaacgagatcctgaccgctgcgggcgctgcgccctatgcc
ggcgtcgagacgctgcgccattgcgacgaccagttgcgcgcgctgatcgacgtctgccat
gtccatggcatcgccgtgctgttcgacgtcgtctacaaccacgccggcggcggcttcgac
gagaacagcatctggttcttcgaccgccagtcgtacggcgatccgaaccgcagcctgtat
ttcaccgaccagggcagggccggcgggcaggtgttcgcctattggaacgccgacgtgcgg
cagtatctcgtcgacaacgccatcatgttctatcgcgaatatcacgccgacggcctgcgc
ttcgacgaggtcagcgtgatggatcatttcggcggctgggcaacctgccagcagctcacc
gaggcattgcgcgcggagaagccggacgcgatccagatcgccgaatactggccggtcaat
ccatgggtggtgaaggacatcgcgatcggcggcgccgggttcgatgcgacctggagcgac
gccctgcggctcgcggtgcgaggggccatcgccagcgcggccggtggcgcaggggctgtc
gtcccgatgcagccgatcgcggccgcgatcgccgatctcagcctcgacaagcgctggcgc
gcggtcaattcgatcgagaaccacgacatcgtctatgccggccgcgagccgcgcatcccg
cgcctcgccgatcccctcgacagccgctgctggtatgcgcgcagccgcagccgcgtcgcc
acgagccttctgctgactgcgccgggcataccgatgctgttcatgggccaggagctgttc
gaggacaggccgtggagcgacacgccgaacccggacacgacgatccactgggcgctgctc
gacggcgaggacaagatcaccgcggatgcgacgcgcttcacgcgcgagctgatcgcgatc
cgccgcacccatccggcgctgaccgccgaaggctgcgccatcgtccacgtccatgacggc
aaccgcgtgctggcgttccaccgctgggacggccagggcgacgacgtggtggtgatcgtc
agcctgagcgagacgccgtggcacgactacgcgatcggctttccggcggtggggacgtgg
cacgaggtgttcaacagcgacgtctacgacaattgggtcaatcccggcgtggtcggcaac
aacggcgcggtgaccgcaggcggcccggcgctgcacggccagccatgctcggctgacgtg
accatcccggcgaatggcgtgctggtgtttgcgcgagggtga

DBGET integrated database retrieval system