KEGG   Agromonas oligotrophica: S58_48960Help
Entry
S58_48960         CDS       T02484                                 

Definition
putative thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
aol  Agromonas oligotrophica
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:aol00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5534828..5536360
Genome map
AA seq 510 aa AA seqDB search
MTTADTARPQLKIRSVALDTGRENVVVISRRSRALRPEVFSGFSRVELRCNSRTLLATLL
ITDDDALVGPDEIGLSEPALRRFAEPAGTLATVSPAAPPDSLEAVRAKIRGETLSDQAIA
AVIDDLAHYRYSDMEIAAFLIGSASFMTSGELLALTRAMANAGTQLKWPEPVVVDKHCIG
GIPGNRTSMVVVPIVAAHGLTIPKTSSRAITSPAGTADTMEVLARVNVGAEEMKSIVAAC
NGCVIWGGHVNLSPADDVLISVERPLSLDTREQMVASILSKKLAAGSTHLLLDLPVGPTA
KLTSGAEAMRLRKLFEFVGDRFGLKVEVITTDGRQPIGNGIGPVLEARDVMAVLGNEPSA
PADLREKSLRLAAHLLEYDPKLRGGAGYHRARELLDSGAALKQMLKIIDAQGPSECRSEL
GDLAFDVRAERDGVVSAIDCLRLNRLARTAGAPVNKGAGIRLFKKIGDRVDQGEPLYRVF
TCDPSEHDLAAAAAGANHGYAFADGANGRP
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgaccacagcagacaccgcccgcccccagctcaagatccgcagcgtcgcgctcgacacc
ggccgcgagaacgttgtcgtcatttcgcgacgctcgcgggcgctgcggcccgaggtcttc
agcgggttcagccgggtcgagctgcgttgcaattcgcggacgctgctcgccaccctgctg
atcaccgacgacgacgccctcgtcggccccgacgagatcggcctgtcggagccggcgctg
cgccgcttcgccgagccggccggtacgctcgcgacggtgtcgcccgcggccccgcccgac
agcctcgaggcggtccgcgccaagatccgcggcgagaccttgagcgaccaggccatcgcg
gccgtgatcgacgatctcgcccactaccgctattccgacatggagatcgcggccttcctg
atcggctcggcgagcttcatgacctcgggcgagttgctggcgctgacgcgcgcgatggcg
aatgccggcactcagttgaaatggcccgagcccgtcgtggtcgacaagcactgcatcggc
ggcattccgggcaaccgcacctcgatggtggtggtgccgatcgtcgccgcccatggcctg
accatccccaagacctcctcgcgcgcgatcacctcgccggccggcaccgccgatacgatg
gaagtgctggcgcgggtcaatgtcggcgccgaggagatgaaatcgatcgtcgccgcctgc
aatggctgcgtgatctggggcggccacgtcaacctgtcgccggccgacgacgtcctgatc
tcggtcgaacgcccgctcagcctcgacacccgcgagcagatggtcgcctcgatcctgtcg
aagaagctcgccgccggctcgacgcatctcctgctcgatctgccggtcggcccgaccgcc
aagctcaccagcggcgccgaggcgatgcggctgcgaaaactgttcgaattcgtcggcgac
cggttcggactcaaggtcgaggtgatcacgaccgatggccgccagccgatcggcaacggc
atcggcccggtgctggaagcgcgcgacgtgatggcggtgctgggcaatgagccatcagcc
ccggccgatctgcgcgagaagtcgctgcggcttgcggcgcatctgctggaatatgatccg
aagctgcgcggcggcgccggctatcatagggcacgcgagctgctcgacagtggtgcggcg
ctgaagcagatgctgaagatcatcgacgcgcaggggccgtcggagtgccgcagcgagctc
ggcgatctcgccttcgacgtccgggctgagcgcgacggcgtcgtctccgcgatcgactgc
ctgcggctgaacaggctggcgcgcaccgccggcgcccctgtaaacaagggcgccggcatc
aggctgttcaagaagatcggcgatcgcgtcgaccagggtgagccgctttatcgcgtgttc
acctgcgacccgtcggagcatgatctggccgcggcggcagccggcgccaaccacggttat
gccttcgctgacggggcgaacggtcgcccctga

DBGET integrated database retrieval system