KEGG   Bradyrhizobium oligotrophicum: S58_49980Help
Entry
S58_49980         CDS       T02484                                 

Definition
(GenBank) GTP cyclohydrolase
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
aol  Bradyrhizobium oligotrophicum
Pathway
aol00790  Folate biosynthesis
aol01100  Metabolic pathways
Module
aol_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:aol00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    S58_49980
Enzymes [BR:aol01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     S58_49980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF EIF_2_alpha
Motif
Other DBs
NCBI-ProteinID: BAM90977
UniProt: M4ZB84
Position
5653423..5654043
Genome map
AA seq 206 aa AA seqDB search
MRETAKTLPFACDPVRVTQDDVEDAIRTILTWIGEDPSREGLSETPARVARAYKSYFAGY
AQNPEDYLRKTFEETAGYDEMVLLRNIPFQSHCEHHMAPIIGRAWVGYVPRSRVVGISKL
ARVVEAYASRLQIQERMTAEIANIIDEVLQPQGVAVVIKAAHHCISSRGVKKHGVDLTTS
RMLGCFRTDPMSRQEFLAMVNADLKD
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcgagacagccaagacactgccgtttgcctgtgacccggtccgtgtcacccaggac
gacgtcgaggacgccatccgcaccatcctgacctggatcggcgaggacccgtcgcgcgag
ggcctctcggagacgccggcccgcgtcgcccgcgcctacaagagctacttcgccggctac
gcgcagaaccctgaagattatctgcgcaagacgttcgaggagaccgccggctatgacgag
atggtgctgctgcgcaacatcccgttccagagccattgcgagcatcacatggcgccgatc
atcggccgcgcctgggtcggctacgtgccgcgcagccgggtcgtcggcatctccaagctc
gcccgggtcgtcgaggcctatgccagccggctgcagatccaggagcggatgacggccgag
atcgccaacatcatcgacgaggtgctgcagccgcagggcgtggcggtggtgatcaaggcg
gcgcatcactgcatcagctcccggggcgtcaagaagcacggggtcgacctcaccaccagc
cggatgctcggctgctttcgcaccgatccgatgagccggcaggagttcctggcaatggtg
aatgccgacctcaaggattga

DBGET integrated database retrieval system