KEGG   Bradyrhizobium oligotrophicum: S58_51200Help
Entry
S58_51200         CDS       T02484                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
aol  Bradyrhizobium oligotrophicum
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:aol00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    S58_51200
Enzymes [BR:aol01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     S58_51200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5798546..5799454
Genome map
AA seq 302 aa AA seqDB search
MGRVIVAGSINMDVVATAERHPRIGETVAGQSVMYFPGGKGANQAVSAAKLGVPTALIGR
LGRDGFGAQLRAFLADQGIDLAAVKESTSASTGTAIITLAKADNTIVVIPGANAELGAED
LAQVALAAGDVAVSQFEIPQATIAAFFQRAKAVGATTILNPAPASAFDSGLFALIDVLVL
NETELGFLADIELGDAPSLQQVKDAVRALKPNSDQTVCVTLGARGAVAVSDGEARLVEGR
AVKAVDTTGAGDCFVGALAARLSQGAPMAEAIGYANLAASISVQRMGAGPSMPSAEEVRA
LL
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgggccgtgtcatcgtcgccggcagcatcaacatggatgtggtggcgacggccgagcgg
catccgcgcatcggcgagaccgtcgccgggcagtcggtgatgtacttcccgggcggcaag
ggtgccaaccaggcggtatcagcggccaagctgggcgtgccgacagcgctgatcggccgg
ctcggccgtgacggattcggcgcgcagttgcgggccttcctcgccgatcagggcatcgat
ctcgctgccgtaaaagagagcaccagcgcatcaaccgggacggcgatcattacgctggcg
aaggccgacaacaccatcgtggtgatcccgggcgccaatgccgagctgggcgccgaggat
ttggcgcaggttgccctggcagcgggagacgtggccgtcagccagttcgagattccgcaa
gcgacgatcgcggcgttcttccaacgcgcgaaggccgtcggcgcgaccacgattctcaac
ccggcccctgccagcgcgttcgacagcgggctgtttgcgctgatcgacgtcctcgtgctc
aacgagaccgagctcggctttctggccgacatcgagctcggcgatgccccctcgctgcag
caggtgaaggacgcggttcgggcgctcaagcccaattccgaccagacggtctgcgtcaca
ctcggcgcgcgcggcgcggttgccgtcagcgatggcgaggccaggctggtcgaaggccgc
gccgtcaaggccgtcgacaccaccggcgccggcgactgcttcgtcggcgcgctcgccgca
aggctgtcgcagggcgcgccgatggccgaggcgatcggctatgccaatctggccgcctcg
atctcggtgcagcggatgggcgccggcccgtcgatgccttcggccgaggaggtgcgcgcg
ctgctctag

DBGET integrated database retrieval system