KEGG   Bradyrhizobium oligotrophica: S58_52400Help
Entry
S58_52400         CDS       T02484                                 

Definition
D-xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
aol  Bradyrhizobium oligotrophica
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aol00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    S58_52400
   00051 Fructose and mannose metabolism
    S58_52400
Enzymes [BR:aol01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     S58_52400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5937112..5938434)
Genome map
AA seq 440 aa AA seqDB search
MNVQAPFFQTGATVAYGGPESRSPLSFRWYDKDRIVRGKRMEDHLRFAVCYWHSLCWPGG
DPFGGETFLRPWQHGDDAMAMARAKADVAFELFRLLDVPFFTFHDVDAAPEGATLKESVA
NLNAIADLFEQKMASAKVRLLWGTANLFSHRRYMAGAATNPDPDVFTYAAGQVRAALEVT
HRLGGQNYVLWGGREGYETLLNTDMKRELDQLGRFVSLVVEHKHKIGFKGPLLIEPKPKE
PTKHQYDFDVATCYGFLRRYDLLDDVKLNIEQNHAILAGHSFQHEIMLAQALGVFGSLDI
NRGDDLLGWDTDQFAMNVPELVLAFHEILKGGGFTTGGLNFDAKIRRQSIDPDDLLHAHV
GSMDACARALIAADEMLEAGALTAPLAQRYAGWDGEEGRAILAGRRSLAALADRAVEGGL
DPQPRSGRQEYLESVVNRYV
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgtccaggctccctttttccagaccggcgcgaccgtggcttatggcgggcccgag
tcacgcagcccgctgtcgtttcgctggtacgacaaggatcgcatcgtccgaggcaagcgg
atggaggaccatctgcgcttcgcggtctgctactggcattcactgtgctggccgggcggc
gatccgttcggcggcgagacatttttgcgcccgtggcagcatggtgatgatgcgatggcg
atggcgcgcgccaaggccgatgtcgcgttcgagctgttccgtctgctcgacgtgccgttc
ttcaccttccatgacgtcgatgccgcgcccgagggcgcgacgctgaaggagtccgtcgcc
aacctcaatgccatcgccgacctgttcgagcagaagatggcctcggccaaggtgcggctg
ctgtggggcaccgcgaacctgttctcgcaccgccgctacatggcgggtgccgcgaccaac
ccagatccggatgtcttcacctatgcggctggacaggtgcgtgccgcgctcgaagtgacg
caccggctcggcgggcagaactacgtgctgtggggcggccgcgagggctatgagaccttg
ctcaacaccgacatgaagcgcgagctcgaccagctcggccgtttcgtctcgctcgtggtc
gagcacaagcacaagatcggtttcaagggcccgctgctgatcgagccgaagccgaaggag
ccgaccaagcatcaatatgatttcgacgtcgccacctgctacggcttcctgcggcgctat
gacctgctcgacgacgtcaagctcaacatcgagcagaaccacgccatcctcgccggccat
tcgttccagcacgagatcatgctggcgcaggcgctcggcgtgttcggctcgctcgatatc
aaccgcggcgacgatctcttgggctgggacaccgaccagttcgcgatgaacgtgccggag
ctggtgctcgcgttccatgagatcctcaagggcggtggcttcaccaccggcgggctcaac
ttcgatgccaagatccgccggcagtcgatcgatcccgacgatctgctgcatgcccatgtc
ggctccatggacgcctgtgcgcgcgcgctgatcgcggccgacgagatgcttgaagctggt
gcgctgaccgcgccgctcgcgcagcgctatgccggctgggacggcgaggaggggcgggcg
atcctggccggccggcgctcgctcgccgcgctggccgaccgcgccgtcgaaggtggcctc
gatccgcaaccgcgctcgggccggcaggaatatctcgagagcgtggtgaaccgctatgtc
tga

DBGET integrated database retrieval system