KEGG   Aspergillus oryzae: AO090020000640Help
Entry
AO090020000640    CDS       T01018                                 

Definition
(RefSeq) unnamed protein product; predicted protein
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
aor  Aspergillus oryzae
Pathway
aor00052  Galactose metabolism
aor00500  Starch and sucrose metabolism
aor01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aor00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    AO090020000640
   00500 Starch and sucrose metabolism
    AO090020000640
Enzymes [BR:aor01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     AO090020000640
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32C Glyco_hydro_32N
Motif
Other DBs
NCBI-GeneID: 5997011
NCBI-ProteinID: XP_001824925
UniProt: Q2U3S3
Position
6
AA seq 593 aa AA seqDB search
MKLSTASALVTSQAAYAASAIDYNAAPPNLSTLANGSLYDTWRPRAHILPPNGRIGDPCG
HYTDPDTGLFHVGFLYNGSGIAGATTDDMVRFRDLNPNGSQFIMPGGKNDPVAVFDGSVI
PKGIDGKPTLLYTSVTSLPIHWSIPYNPGAETQSLAVTSNGGRNFTKLDRPPVIPLPPSD
SDVTAFRDPYAFQSPELDAAADSAPGTWYTAISGGVHEDGPGQFLYRQDQKEMSLESWEY
LGLWWQEKVNTTWGNGDWAGGWGFNFETGNVFGLNEEGYSVDGEMFMTLGTEGSGTPIVS
QVSSIHDMLWAAGNVSNNGNVTFTPTMAGVFDWGASGYAAAGHILPATSQVSTKSGAPDR
FISFVWLTGDLFEQAKGYPTSQQNWVGTLLLPRELHIKTISNVVDNELAREEGSSWRVER
GQSGIELKTLGIDIARETREALMSGPKITEPERTSKEAGLVPFQVSPTTKFHVLTAQLSF
PRSARNSDLQAGFQVLSSDLESTTIYYQFSNESIIVDRSNTSAAAKTTNGIVSTNESGRL
RLFDLQGDAQEIETLDLTVVVDNSVLEIYANGRFALSTWARYVFCDGRQQGIG
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atgaagctctcaaccgcgagtgccttggtcaccagccaggcggcctacgctgcctccgcc
atcgattacaacgcagctcccccaaacctttcgactttggccaatggctctctgtatgac
acgtggagacctagagctcatatcctcccaccaaacggccgaattggcgacccgtgtggt
cattacactgatcctgacaccggtttgttccacgttggcttcctgtacaatggcagtggt
atcgcaggcgctacgaccgatgatatggtcagattccgtgatctgaatcccaacggaagt
caattcatcatgcctggtggcaagaatgatcctgtagcggtctttgatggctctgtaatc
cctaagggaattgacggcaagcccaccctactctacacctccgtcacatcactccctatc
cattggtcaatcccctacaacccaggagccgaaacgcaatccttggccgtcacatccaac
ggcggtcgcaattttaccaagctcgatcgtccaccggtcattcccctccctccgtccgac
agcgatgtgaccgctttccgtgacccctacgctttccaaagcccggagctggacgctgcc
gcggacagcgccccgggtacctggtacacagccatctctggtggtgtccacgaagatggc
cctggtcagttcctctatcgtcaggaccagaaggaaatgagcctcgagagctgggagtat
cttggcttgtggtggcaggagaaggtcaacacgacctggggtaacggcgactgggcagga
ggatggggcttcaacttcgagaccggtaacgtcttcggtctgaacgaggaagggtacagc
gtcgatggtgagatgttcatgaccttgggtactgagggatccggaactcctattgtgtcc
caggtgtcatccattcacgatatgctgtgggctgctggcaacgtctctaacaacggaaat
gtcactttcaccccaactatggccggtgtcttcgactggggtgcttctggctatgctgcc
gctggtcatattctgcccgcaacttctcaggtgtccacaaagagtggcgcccccgaccgt
ttcatctcgtttgtctggttgaccggagacttgttcgagcaggccaagggttaccccact
tcgcaacaaaactgggttggcacccttctgcttcctcgcgagctgcacatcaagaccatc
tcaaacgtggttgataatgagcttgcccgggaagagggatcatcttggcgcgtagagcgt
ggccagtctggcattgagctgaagaccctgggaattgatattgctcgggagacgcgtgaa
gctctcatgtctgggccgaagatcactgagcccgagcgcacatcgaaggaggctggcctc
gtgcctttccaggtctccccgaccaccaagttccacgtcctgaccgcccagctgtctttc
cctcgctctgcccgtaattctgatctccaggccggattccaagtgctgtcgtctgacctc
gaaagcaccactatctactaccagttctccaatgagtcaatcatcgtcgaccgcagcaac
accagtgctgccgcgaagaccaccaatggaatcgtcagcaccaatgagtctggacgtctc
cggttgttcgatttgcagggcgatgcccaggaaattgagactctggacctcacggtcgtt
gtggataactctgtcctcgagatctatgccaatggacgttttgccctgagtacttgggct
cggtatgtattctgtgatggtcgacaacaaggcattggctaa

DBGET integrated database retrieval system