KEGG   Aspergillus oryzae: AO090701000400Help
Entry
AO090701000400    CDS       T01018                                 

Definition
(RefSeq) unnamed protein product; beta-fructofuranosidase (invertase)
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
aor  Aspergillus oryzae
Pathway
aor00052  Galactose metabolism
aor00500  Starch and sucrose metabolism
aor01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aor00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    AO090701000400
   00500 Starch and sucrose metabolism
    AO090701000400
Enzymes [BR:aor01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     AO090701000400
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 5995302
NCBI-ProteinID: XP_001823245
UniProt: Q2U8K3
Position
5
AA seq 525 aa AA seqDB search
MYIKPFILPALAAVAQAASYSGDLRPQTHFSPPSNFMNDPNGLFYDSKRGVYHLYYQYNP
TATVAGNQHWGHATSPDLYHWTNQPIALAGDKPEEYIFSGSAVVDSNNTSGFFPDQDDGV
IAIYTVDTPTLETQHIAYSRDGGYTFTKYENNPVIDIGSKQFRDPQVVWHPETQQWVMTI
AYAQDLVIGFYTSPNLKDWTHASNFTQEGLPGDQFECPNLVKLSVDRAVSEETSKFVLFI
SVNPGAPLGGSGTFYVVGDFNGTHFTSEVVQETLFDFSKDNYAAQWYSGIPENEPPVSIG
WASNWDYTEEVPTGPLEGWRSAMTLPRAHTLTKVNGVWTVTHSPFEGLSALKGRQLVSKS
VHSGDVKANFSGVPSNAVYFDVTLKGIDVAKPTGRVNFNFTSSVSGEFLDGGVSLDDSSF
WISRAGTHLFTIEDNGNYTSSSTTTISSFGNGTFSFSGVIDRSVFEVFLGQDGIQSGTMT
FFPSSPLDTLAVSAEDLGDRASVSVKAWGLQSGWNSTTASKRFRA
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgtatatcaaaccattcatccttcctgcccttgcggcagttgcacaagctgccagctat
tctggagaccttcggcctcaaactcacttctctccaccttccaatttcatgaacgatcca
aacggtctcttctatgatagcaagaggggcgtgtatcacttatactatcagtataatcct
acagcgacagtagctgggaatcagcactggggtcatgccaccagccctgatctataccac
tggacgaatcaacctatcgccctcgctggggataagcctgaggagtatatcttttcaggc
tctgctgtggtggacagcaacaacacctcaggattctttcccgatcaggacgatggcgtc
atagccatctacacagtagataccccgacactggaaacacagcacattgcttattctcgc
gatggtggatacactttcaccaagtatgagaacaacccggtcatcgacattggctcaaag
cagttccgtgacccgcaggtggtgtggcatcctgaaactcagcaatgggtgatgactatt
gcctatgcgcaggacttggtcattggattttatacctcgcccaatctcaaagactggaca
catgcgtcgaatttcacccaggaagggctgccgggcgaccaattcgaatgccccaacttg
gtcaagctttcggtggatcgcgctgtgtctgaggagacgagcaagttcgtgcttttcatt
tccgtgaaccctggcgctcctcttggaggttcgggaacattttatgtggtcggcgatttc
aacggcacccatttcacctctgaagttgttcaggagacactttttgatttctctaaggac
aactatgcggctcagtggtattctggtattcctgagaacgagcctcctgtctccattggg
tgggctagcaactgggattacaccgaagaagtccccactggcccgcttgaaggctggagg
agcgccatgactttacctagagcgcacaccctaaccaaggtcaacggagtctggactgtg
actcacagcccgtttgagggcctttctgctcttaagggcagacagcttgtgagcaagagt
gtccactctggggatgtgaaggcgaacttctctggggtcccatcgaatgcagtatatttc
gatgtgacactgaagggcatcgatgttgccaagcctaccggacgcgtaaacttcaacttt
acctcctctgtatcgggtgaattcctcgacggaggggtgtctctggatgatagttctttc
tggatcagcagagctggaacccatcttttcacgattgaagataatggaaattatacatca
tcttctacaacaactatctcctcctttggcaacggcacattcagcttctcgggcgttatt
gaccgctctgtgtttgaagtcttccttggtcaggacgggatccaaagcggaaccatgact
ttcttcccaagctccccactcgataccttggctgtttccgcagaggatctcggtgatcgg
gctagcgttagtgttaaggcttggggccttcagagcggctggaactcaacaacagccagt
aagaggttccgcgcctga

DBGET integrated database retrieval system