KEGG   Aspergillus oryzae: AOR_1_1012194Help
Entry
AOR_1_1012194     CDS       T01018                                 

Gene name
AO090012000581
Definition
N-(5'-phosphoribosyl)anthranilate isomerase
Orthology
K13501  
anthranilate synthase / indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.3.27 4.1.1.48 5.3.1.24]
Organism
aor  Aspergillus oryzae
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:aor00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AOR_1_1012194 (AO090012000581)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AOR_1_1012194 (AO090012000581)
Enzymes [BR:aor01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     AOR_1_1012194 (AO090012000581)
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     AOR_1_1012194 (AO090012000581)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     AOR_1_1012194 (AO090012000581)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 765 aa AA seqDB search
MAGSDLVDHSPHHPTKAARLDSASNVILIDNYDSFTWNVYQYLVLEGATVQVFRNDELSL
DELIAKKPTQLVVSPGPGHPTTDAGISNAAIQYFSGKVPVFGVCMGQQCIISSFGGKVDV
TGEILHGKTSVIKHDGKGAYEGLPTSLAVTRYHSLAGTHSTIPDCLEVTSYAQLGEDSSK
TVIMGVRHKELAVEGVQFHPESILTEYGRGMFRNFLKLTAGTWEGNGKQSSAQTASNSTP
KVDKKTSILEKIYDHRRAAVAIQKTIPSQRPADLQAAYDLNIAPPQVSFPARLRQSPYPL
SLMAEIKRASPSKGMIAENACAPAQAREYAKAGASVISVLTEPEWFKGSIDDLRAVRQSL
EGVTNRPAILRKEFVFDEYQILEARLAGADTILLIVKMLSVELLTRLYHYSRSLGMEPLV
EVNTPEEMKIAVQLGAEVIGVNNRDLTSFEVDLGTTSRLMDQVNENTIVCALSGISGPKD
VEAYKKEGVKAILVGEALMRASNTSAFVAELLGGSYEKSTQTSRASPLVKICGTRSEDGA
RAAIEAGADLVGIIQVQGRKRTVSDDVALRISQVVKSTKRPVTHTASTTQGTSNATSVDY
FDHSTNVLRHPNRALLVGVFQNQPLSYILEQQQKLELDVVQLHGSEPLEWAKLIPVPVIR
KFGLDETGIARRAYHTLPLLDSGAGGSGELLDQSGVQTVLDSDAGLRVILAGGLDPTNVA
DTIKKLGSSGHKVVGVDVSSGVESDGVQDPSKIHAFVQAVRGLQQ
NT seq 2298 nt NT seq  +upstreamnt  +downstreamnt
atggcgggctccgatctcgttgaccattccccccaccatcccactaaagccgcacggctt
gacagcgcatccaatgtcattttgatcgacaactatgattctttcacctggaatgtctat
cagtatctggtcctcgagggcgccactgtccaggtgtttcgcaatgatgaattatccttg
gacgaattgatcgccaagaagccgactcaattggtcgtcagccctggtccgggccacccg
acaaccgacgctggaatcagtaatgctgcaattcaatacttcagcggtaaagtacctgtt
tttggtgtgtgtatgggtcagcaatgcatcatctcttccttcggtggcaaagtcgatgtc
acaggcgagatcttgcatggtaagacatcggtgataaaacatgacggtaagggtgcatat
gaagggctgccgacctccctcgccgtgactaggtatcattcccttgctggaacacactca
acgatccctgattgcctggaggtaacgtcttacgcccagctgggtgaggacagtagtaag
accgttatcatgggtgtgagacacaaggagcttgcagtggaaggtgtccagtttcatcct
gaaagtattctcacagagtacggccgagggatgtttaggaacttcctcaaacttacagcg
ggtacatgggagggtaacggcaaacaatccagtgcacagactgcctcgaatagcacccca
aaggtagacaagaagacttccatcttagagaagatatatgatcaccgcagggctgccgtt
gccatccagaagactattccttcacaacggcccgcggatcttcaggctgcttacgacctc
aacattgctcctccacaagtctcattccctgcccgtctgagacaatcaccttatccgctg
tctcttatggctgaaataaagcgcgcttccccttccaagggaatgattgcggagaacgca
tgtgcccctgcccaggctagagagtacgctaaggccggcgccagcgttatttctgtcctc
actgagccagaatggttcaaaggtagcatcgacgatttgcgtgccgttcgtcagagctta
gaaggagttacaaacagacctgcaatcttaagaaaggagtttgtttttgacgaatatcag
attcttgaagcccgtcttgctggggctgatactatcctgctcatcgtgaagatgctaagc
gtcgagcttcttacaagattgtatcactattctcgcagcttgggaatggagcctctcgta
gaggttaatactccggaggaaatgaagatcgcggtgcagcttggagccgaggtgattggc
gtgaacaacagagacttgacgagcttcgaggttgacctcggtaccacgagtcgtctcatg
gaccaggttaacgagaatactatcgtttgcgctcttagtggaatttccggacccaaggat
gtcgaggcttacaagaaggaaggtgtcaaagcaattctcgtgggagaggcacttatgcgg
gcatctaacacatctgcttttgttgcagagctgctcggggggtcttacgagaaatctact
caaacttcacgagcctcgccgttagtcaagatctgcggtacacgatcagaagatggggct
cgggcggcaattgaggccggtgctgatttggttggtattattcaggtacagggacgaaag
cgtactgtttcagatgatgttgctcttcgcatttctcaagttgtgaagtccacgaagcga
cctgtcactcataccgcttcgacgactcaaggaacatcaaatgcaacctcggttgattac
tttgatcattccactaatgtcctacgccatcccaaccgagctctgctcgtgggtgtgttc
cagaatcagccattgtcgtacatcctagagcagcagcaaaagctggaactcgatgtggtc
caattacacggttctgagccattggagtgggctaagttaataccggtgcctgtaatccgc
aaattcggtcttgacgagactggaattgcacgaagagcctaccatactttgcccttactt
gattctggagctggcggctcgggtgaattgcttgatcagtccggtgttcaaaccgttctg
gacagcgatgctggcctgcgtgttatcctggctggaggattggatcccacaaacgttgct
gacacaatcaagaagctagggagctctggtcacaaggttgttggggtagatgtcagttct
ggtgtggagtcggatggcgttcaggatccgagtaaaatacatgcctttgtgcaggcagtg
agaggacttcaacagtaa

DBGET integrated database retrieval system