KEGG   Aspergillus oryzae: AOR_1_1028194Help
Entry
AOR_1_1028194     CDS       T01018                                 

Gene name
AO090012000590
Definition
tyrosinase
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
aor  Aspergillus oryzae
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aor00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    AOR_1_1028194 (AO090012000590)
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    AOR_1_1028194 (AO090012000590)
Enzymes [BR:aor01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     AOR_1_1028194 (AO090012000590)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 387 aa AA seqDB search
MRSWVPFVAALAALSPATASPTSMDQWDVLAGKALGNQILYHYTNPEASSTCTPYTASAR
REWGALSKKERRDYIDAVLCLSSKPSKSDPSFAPGARSRYDDFVAVHINQTMFIHSTGNF
LTWHRYFTWAYEQALRNECGYTGSQPYWAWNKYADDPVNSPIFDGSEYSMSGDGAFVPHN
ATEAAPGIFLQPSNGGGCVKSGPFKNFTVNLGPLLPSLKIPGLVAQNGTGLNYNPRCLRR
DISKQAAQWTTTKNVVDLIVNETDIWDYETTMQGDFPRGFLGLHSGGHYTIGGDPGGDFF
ASPGDPAFFLHHAAIDRAFWTWQNLDPVKRTYVVNGPTVLPGIVESPPNATLDDVVDMSA
ALAPPKTIRELLDTTGGTGGPFCYIYL
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagttgggttccattcgtcgcagctcttgctgccctatcaccagcaactgcatct
cccacttccatggatcaatgggatgtactcgctggaaaagccctgggaaatcaaatcctg
tatcactacacaaacccggaagccagcagcacctgtaccccttacaccgcgtcggctcgc
agagaatggggggctctatccaagaaagaacgacgagactacatcgatgccgttctctgt
ctatcctctaagccttcaaagtccgacccctccttcgctcctggggctcgttcccgctac
gatgacttcgtagctgtgcacatcaaccagacgatgttcatccattcaacgggcaacttc
ctaacctggcaccgctacttcacctgggcctacgaacaagccctacgaaacgaatgcggc
tacacaggctcccagccctactgggcctggaacaaatacgccgacgacccagtcaactcg
cccatcttcgacggctcagaatacagcatgtcaggagacggcgcattcgtcccccacaat
gccaccgaggcggcacccggaatcttcctccagccttcgaatggaggcggctgcgtcaaa
tccggtcccttcaagaacttcacagtgaacctcggccccctcctcccaagtctcaagatc
ccaggcctggtcgcccaaaacggcaccggcctgaactataacccaagatgtctccgcaga
gatatctccaagcaagccgcccaatggaccacaactaaaaacgtcgtggacctgatcgtc
aacgaaacagatatctgggattacgagacgacaatgcagggtgacttccctcgtggcttc
ctcggtctgcatagcggtggacattataccattggtggtgatcctggcggtgactttttt
gcctcccccggtgatcccgctttcttccttcaccatgccgcgattgaccgggcgttctgg
acttggcagaatctggaccctgtgaagcggacttatgttgttaatgggccgactgtgctt
cctggtattgtggagtcgccgcccaatgctacgttggatgatgttgtggatatgagtgct
gctttggcgccgccgaagactattagggagttgttggatactactggcgggactgggggg
cctttttgttatatttatctgtga

DBGET integrated database retrieval system