KEGG   Aspergillus oryzae: AOR_1_1028194Help
Entry
AOR_1_1028194     CDS       T01018                                 

Gene name
AO090012000590
Definition
tyrosinase
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
aor  Aspergillus oryzae
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:aor00350]
Metabolism; Metabolism of cofactors and vitamins; Riboflavin metabolism [PATH:aor00740]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 387 aa AA seqDB search
MRSWVPFVAALAALSPATASPTSMDQWDVLAGKALGNQILYHYTNPEASSTCTPYTASAR
REWGALSKKERRDYIDAVLCLSSKPSKSDPSFAPGARSRYDDFVAVHINQTMFIHSTGNF
LTWHRYFTWAYEQALRNECGYTGSQPYWAWNKYADDPVNSPIFDGSEYSMSGDGAFVPHN
ATEAAPGIFLQPSNGGGCVKSGPFKNFTVNLGPLLPSLKIPGLVAQNGTGLNYNPRCLRR
DISKQAAQWTTTKNVVDLIVNETDIWDYETTMQGDFPRGFLGLHSGGHYTIGGDPGGDFF
ASPGDPAFFLHHAAIDRAFWTWQNLDPVKRTYVVNGPTVLPGIVESPPNATLDDVVDMSA
ALAPPKTIRELLDTTGGTGGPFCYIYL
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagttgggttccattcgtcgcagctcttgctgccctatcaccagcaactgcatct
cccacttccatggatcaatgggatgtactcgctggaaaagccctgggaaatcaaatcctg
tatcactacacaaacccggaagccagcagcacctgtaccccttacaccgcgtcggctcgc
agagaatggggggctctatccaagaaagaacgacgagactacatcgatgccgttctctgt
ctatcctctaagccttcaaagtccgacccctccttcgctcctggggctcgttcccgctac
gatgacttcgtagctgtgcacatcaaccagacgatgttcatccattcaacgggcaacttc
ctaacctggcaccgctacttcacctgggcctacgaacaagccctacgaaacgaatgcggc
tacacaggctcccagccctactgggcctggaacaaatacgccgacgacccagtcaactcg
cccatcttcgacggctcagaatacagcatgtcaggagacggcgcattcgtcccccacaat
gccaccgaggcggcacccggaatcttcctccagccttcgaatggaggcggctgcgtcaaa
tccggtcccttcaagaacttcacagtgaacctcggccccctcctcccaagtctcaagatc
ccaggcctggtcgcccaaaacggcaccggcctgaactataacccaagatgtctccgcaga
gatatctccaagcaagccgcccaatggaccacaactaaaaacgtcgtggacctgatcgtc
aacgaaacagatatctgggattacgagacgacaatgcagggtgacttccctcgtggcttc
ctcggtctgcatagcggtggacattataccattggtggtgatcctggcggtgactttttt
gcctcccccggtgatcccgctttcttccttcaccatgccgcgattgaccgggcgttctgg
acttggcagaatctggaccctgtgaagcggacttatgttgttaatgggccgactgtgctt
cctggtattgtggagtcgccgcccaatgctacgttggatgatgttgtggatatgagtgct
gctttggcgccgccgaagactattagggagttgttggatactactggcgggactgggggg
cctttttgttatatttatctgtga

DBGET integrated database retrieval system