KEGG   Aspergillus oryzae: AOR_1_1046164Help
Entry
AOR_1_1046164     CDS       T01018                                 

Gene name
AO090001000584
Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
aor  Aspergillus oryzae
Pathway
Sulfur metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:aor00920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 415 aa AA seqDB search
MGHRSAKSAGRLSIRQPRRLFSRLVLCSTLLLGVSIVLKSRHRLSSFFTHFLTPTYSYTQ
VTTMSYQQERYIAELAVQRATLLTQKVFNEKAKGTVSKDDKSPVTIGDFGAQALIIQAIR
KNFPNDEIVAEEEASSLREDKTLSAEIWRLVKDIKLDDSESDEILGGPLPSEEAMLDIID
QGKSAGGAKGRIWALDPIDGTKGFLRGGQYAVCLGLIEDGDVKVGAIGCPNLPVNDSDTM
SASIGVDQHSGAGNGVLFSAIKGAGSISRPLKNGALAESKSISMRPVPNIAQAVFCEGVE
AAHSAQGDNAAVAQRLGITAPSVRLDSQAKYCSIARGAGDIYLRLPVKKDYQEKIWDHAA
GDLIVREAGGQVTDIYGQQLDFSKGRTLAANKGVVAAPKALQDQVIDAVKIVLKL
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgggtcaccggtctgcgaaatcggcaggccgtctctcaattcgccaaccgcgacggtta
ttctcccgtctagtcctctgctccactctcctactgggagtcagcattgtcctaaaaagc
cgccaccgtctcagctccttcttcactcacttccttactcctacatactcatacactcaa
gtcacaactatgtcttaccaacaggaacgctacatcgccgaactcgcagtccaacgagct
actctcctcacccagaaggtctttaacgaaaaggccaagggtaccgtatcgaaagatgac
aagtcgcccgtgaccatcggtgactttggtgcccaggctttgatcattcaggctatccgc
aagaacttcccaaatgatgagattgtcgccgaagaagaggctagttccctccgtgaggat
aaaacactgagtgccgaaatctggagactggttaaggatatcaagctggatgacagtgag
agcgatgagatccttggaggacccttgccaagtgaagaagcaatgttggacattatcgat
cagggcaagagcgcgggaggcgcgaagggtcgcatctgggctttggaccctatcgacggt
acgaagggattcctgcgtggtggccagtatgccgtctgtctcggcttgattgaggatggt
gacgtcaaggtgggagcgattggctgccccaacctgcctgttaatgactccgatacgatg
tctgcatcgatcggtgttgaccagcacagcggtgctggtaacggagtccttttctcagct
atcaagggcgccggatccatcagccggcccctgaagaatggcgctcttgccgagagcaag
tctatctccatgcgtccggtaccaaacattgcgcaggctgtcttctgcgaaggagtggag
gctgcccactcggctcagggtgataatgctgctgttgcccagcgccttggtattaccgcc
cccagcgtgcgactggattctcaggccaagtactgctctattgccagaggtgccggtgac
atctatctacgtctgcctgtgaagaaggactaccaagagaagatctgggatcatgctgct
ggagatctcatcgtgcgtgaagctggcggccaagtaacggacatctacggtcagcaattg
gatttcagcaagggccggaccttggctgccaacaagggagttgtcgctgcacccaaggcc
cttcaggaccaggtgattgatgctgtgaagattgtcctgaagctgtga

DBGET integrated database retrieval system