KEGG   Aspergillus oryzae: AOR_1_1046164Help
Entry
AOR_1_1046164     CDS       T01018                                 

Gene name
AO090001000584
Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
aor  Aspergillus oryzae
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aor00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    AOR_1_1046164 (AO090001000584)
Enzymes [BR:aor01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     AOR_1_1046164 (AO090001000584)
Transfer RNA biogenesis [BR:aor03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    AOR_1_1046164 (AO090001000584)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 415 aa AA seqDB search
MGHRSAKSAGRLSIRQPRRLFSRLVLCSTLLLGVSIVLKSRHRLSSFFTHFLTPTYSYTQ
VTTMSYQQERYIAELAVQRATLLTQKVFNEKAKGTVSKDDKSPVTIGDFGAQALIIQAIR
KNFPNDEIVAEEEASSLREDKTLSAEIWRLVKDIKLDDSESDEILGGPLPSEEAMLDIID
QGKSAGGAKGRIWALDPIDGTKGFLRGGQYAVCLGLIEDGDVKVGAIGCPNLPVNDSDTM
SASIGVDQHSGAGNGVLFSAIKGAGSISRPLKNGALAESKSISMRPVPNIAQAVFCEGVE
AAHSAQGDNAAVAQRLGITAPSVRLDSQAKYCSIARGAGDIYLRLPVKKDYQEKIWDHAA
GDLIVREAGGQVTDIYGQQLDFSKGRTLAANKGVVAAPKALQDQVIDAVKIVLKL
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgggtcaccggtctgcgaaatcggcaggccgtctctcaattcgccaaccgcgacggtta
ttctcccgtctagtcctctgctccactctcctactgggagtcagcattgtcctaaaaagc
cgccaccgtctcagctccttcttcactcacttccttactcctacatactcatacactcaa
gtcacaactatgtcttaccaacaggaacgctacatcgccgaactcgcagtccaacgagct
actctcctcacccagaaggtctttaacgaaaaggccaagggtaccgtatcgaaagatgac
aagtcgcccgtgaccatcggtgactttggtgcccaggctttgatcattcaggctatccgc
aagaacttcccaaatgatgagattgtcgccgaagaagaggctagttccctccgtgaggat
aaaacactgagtgccgaaatctggagactggttaaggatatcaagctggatgacagtgag
agcgatgagatccttggaggacccttgccaagtgaagaagcaatgttggacattatcgat
cagggcaagagcgcgggaggcgcgaagggtcgcatctgggctttggaccctatcgacggt
acgaagggattcctgcgtggtggccagtatgccgtctgtctcggcttgattgaggatggt
gacgtcaaggtgggagcgattggctgccccaacctgcctgttaatgactccgatacgatg
tctgcatcgatcggtgttgaccagcacagcggtgctggtaacggagtccttttctcagct
atcaagggcgccggatccatcagccggcccctgaagaatggcgctcttgccgagagcaag
tctatctccatgcgtccggtaccaaacattgcgcaggctgtcttctgcgaaggagtggag
gctgcccactcggctcagggtgataatgctgctgttgcccagcgccttggtattaccgcc
cccagcgtgcgactggattctcaggccaagtactgctctattgccagaggtgccggtgac
atctatctacgtctgcctgtgaagaaggactaccaagagaagatctgggatcatgctgct
ggagatctcatcgtgcgtgaagctggcggccaagtaacggacatctacggtcagcaattg
gatttcagcaagggccggaccttggctgccaacaagggagttgtcgctgcacccaaggcc
cttcaggaccaggtgattgatgctgtgaagattgtcctgaagctgtga

DBGET integrated database retrieval system