KEGG   Aspergillus oryzae: AOR_1_1062184Help
Entry
AOR_1_1062184     CDS       T01018                                 

Gene name
AO090009000634
Definition
alcohol dehydrogenase 2
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
aor  Aspergillus oryzae
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:aor00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    AOR_1_1062184 (AO090009000634)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AOR_1_1062184 (AO090009000634)
  Lipid metabolism
   00071 Fatty acid degradation
    AOR_1_1062184 (AO090009000634)
  Amino acid metabolism
   00350 Tyrosine metabolism
    AOR_1_1062184 (AO090009000634)
Enzymes [BR:aor01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     AOR_1_1062184 (AO090009000634)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 350 aa AA seqDB search
MSIPEMQWAQVAEQKGGPLIYKQIPVPKPGPDEILVKVRYSGVCHTDLHALKGDWPLPVK
MPLVGGHEGAGVVVARGDLVTEFEIGDHAGLKWLNGSCLACEFCKQADEPLCPNASLSGY
TVDGTFQQYAIGKATHASKLPKNVPLDAVAPVLCAGITVYKGLKESGVRPGQTVAIVGAG
GGLGSLALQYAKAMGIRVVAIDGGEEKQAMCEQLGAEAYVDFTKTQDLVADVKAATPEGL
GAHAVILLAVAEKPFQQAAEYVRSRGTVVAIGLPAGAFLRAPVFNTVVRMINIKGSYVGN
RQDGVEAVDFFARGLIKAPFKTAPLQDLPKIFELMEQGKIAGRYVLEIPE
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatccccgagatgcagtgggctcaagtggccgagcagaagggcggtccgctcatc
tacaagcagattcccgttcctaaaccaggaccagatgagattcttgtcaaggttcgctac
tcgggcgtctgccacaccgaccttcacgccttgaagggtgactggcccctcccagtgaag
atgcccctcgtaggtggacacgagggagctggtgtggtcgtcgccaggggtgacctggta
actgaattcgagattggcgaccacgctggtctcaaatggctcaatggatcctgtctcgcc
tgtgaattctgtaagcaagccgacgagcctctctgtccgaatgcttctttgtccggctac
acggtcgacggcactttccagcagtacgccattggtaaggccactcacgcctccaagctt
ccaaagaacgttcctctggacgctgtcgcccccgtcctctgtgcgggtatcacggtctac
aagggactgaaagaatctggtgttcgcccgggccaaaccgttgccatcgtcggtgctggt
ggtggtcttggttctttggcgttgcagtacgcaaaggcaatgggcatccgtgtagtggcc
attgatggcggagaagagaagcaagccatgtgcgagcaactaggcgccgaggcatacgtc
gacttcactaagacccaagatctcgttgcagatgtcaaagccgctacccccgaaggccta
ggtgcacatgccgttatacttcttgccgtcgccgaaaagcccttccagcaggctgccgaa
tacgtccgctcgcgcggtaccgtcgttgctattggtttgcccgccggtgccttcctcagg
gcccctgttttcaataccgttgtccgtatgatcaacatcaagggaagctacgtcggtaac
cgtcaagacggcgtggaggctgtggacttcttcgcccgcggcctcatcaaggctccattc
aagactgcaccattgcaggatctcccgaagatcttcgagctcatggagcaaggcaagatc
gccggccgttatgtgctcgagattcccgaatga

DBGET integrated database retrieval system