KEGG   Aspergillus oryzae: AOR_1_1074014Help
Entry
AOR_1_1074014     CDS       T01018                                 

Gene name
AO090026000590
Definition
WD repeat-containing protein mip1
Orthology
K07204  
regulatory associated protein of mTOR
Organism
aor  Aspergillus oryzae
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 1433 aa AA seqDB search
MKDPNLIMEQKATMEPQETSGHAEPRKNTTKSVRVAFGPDLETHIPPRDKSPAPGPGHHR
SFTTVERRHPPVTTPDRPTSSSAGEGPAVIDDNPRLTSDRASDSARPSTLKRAKSDYGPR
LGFDKSPGEDEEDFAMRHGWQEEYTSSEYLKILHSNFYMYFTEKRHETNGMPRDPVGSWP
SQDWRMKDRLKTVSAALAICLNIGVDPPDVVKTNPTAKLECWVDPTSTTGGGQTKIMEQI
GKKLQEQYETLSLRTRYKQYLDPSVDETKKFCISLRRNAKDERVLFHYNGHGVPLPTQSG
EIWVFNKNYTQYIPVSLYDLQSWLAGPSLFVFDVSHAGNIVQNFHTFVEKHEKENIEAKK
RDPNVITQNYGDCIILAACQKSESLPTNPDLPADLFTCCLTTPIEIALRYFILQNPLQSN
ISIDDFRVPGRLQDRRSPLGELNWIFTAITDTIAWNTLPRALFKKLFRQDLMVAALFRNF
LLSERIMRTYKCHPISSPELPETHHHPLWKSWDLAVEMVLAQLPALIDHEEGRRQYEYQH
STFFAEQLTAFEVYLSSGPTEKTPPDQLPIVLQVLLSQAHRLRALILLSKFLDLGPWAVH
LALSIGIFPYVVKLLQSAAQELKPVMVFIWARIMAVDHTVQNDLLKDNGIHYFISILNPS
SPIPVGNASEHRAMCAFIVSIFCKNYPQGQNVCLSAELFDSCLRHLMDVENPLLRQWSCL
CISMLWSDFPEAKWMGIRCAAPARLCELNFDPVPEVRAAMLHAVTTFLGIPDLTDQVAQI
EESLAMAVLPMASDGSVLVRKELLVFFSTFVRRYQNKFLVAAYDELQDEKQSLLSKVEQA
TPRGHSFEDAPNGSANGSLSSYKTQKLSRNSTFGTIWKQLLILSVDPHPDIAQDAATIVD
YIHLSLVQSPMASLTEKIRQEIMDLSNSLSQKTQIRERLESKKTAPPPAPPSVAPPKQEG
YLSLSLKRTASVAASLKNLAFGGSLTEPQSPQLSASDKSRMPMTPRGRAPPEWTRPPEVN
DQVAPATAYHQAPTPTSRGFEPKASSTPPTVPLMSRFLDWSTEYFREPQMKPNEPDEPGS
ADYNERLWRRSRNERIITETQPLKSKAGSSRWDTSIALLSNSSQPMKMCFHQFEDHIAVA
DDKDTIAIWDWQSHKRLNRFSNGNPPGSKINEVRYINEDDQALLLTGSSDGVLKIFRNYE
SSRDVEIVTAFRALPELIPSNRNAGLVLDWQQGQGKALVAGDVKVIRVWNAATEVCTNDI
PARSGSCITSLTSDQVAGNIFVAGFGDGAVRVFDQRIKPTTSMVKVWREHKQWITNVHMQ
RGGLRELVSGSRNGEIRLWDLRMDNPISTLYATKDTLRTLSVHEHAPVFMVGTNRHEVKT
FNVDGTFLSTFEPYSSFLHHNRSSPIASTAFHPHRTVLACAALNDNHINLVSC
NT seq 4302 nt NT seq  +upstreamnt  +downstreamnt
atgaaggatcccaatttgattatggaacagaaagccactatggagccccaagaaaccagc
ggtcatgctgaaccccgaaagaacaccaccaaatccgtccgcgtggccttcggtccggac
ctggaaacgcatatccctcctcgcgataagtcacccgcgcctgggccaggacaccacaga
tcgtttactaccgtggagcggagacacccccctgtaaccacccctgacagaccgacgagt
tcctcggcaggtgaaggcccagccgtcattgatgataaccctcggttaacatctgatcgg
gcatcggattcagcacggccgtcgacattgaagcgggctaaaagcgactatggaccaaga
ctggggtttgacaagtctcctggagaggatgaagaggactttgccatgcgccatggatgg
caggaagagtacacttcgagcgaataccttaaaatcttacactcgaatttttacatgtat
ttcacggaaaaacgccatgagacaaacggcatgccgagagatcccgtgggaagctggccc
agccaggactggcgtatgaaggaccgtttgaaaaccgtttctgcggccttggctatatgc
ttgaacatcggtgttgatcccccggatgtggtcaagacgaaccctacggctaagctcgaa
tgttgggttgacccaacatcgactactgggggcgggcagaccaagatcatggagcagatt
ggaaaaaagctacaggaacaatatgaaacacttagcctaagaactaggtacaagcagtat
ctcgacccatctgttgatgagacgaaaaagttttgcatatctctacgtcgtaacgccaaa
gacgagagagttcttttccattataacggccatggtgtccctttacccacccagtctggt
gaaatatgggtcttcaacaaaaattatactcagtacatcccggtgtccttgtatgatttg
cagtcctggcttgcaggccccagccttttcgtttttgacgtatcacatgctgggaatatt
gtccagaattttcacacctttgtcgagaaacatgaaaaagagaatatcgaagcaaagaag
cgggaccctaatgtgatcacccaaaactatggggattgcataatcctcgccgcgtgccag
aagagcgagtcgcttccaaccaaccctgacctccccgcagatcttttcacttgttgtttg
acgacgcccatcgagatcgctctgagatacttcatcctccagaatcctctgcagagtaac
atctccattgatgatttccgagtcccgggtcgtttgcaggaccgcaggagcccccttgga
gaactaaactggattttcactgctattacggacacgatcgcgtggaataccttgccccga
gctctctttaagaagctcttccgtcaagatttaatggtagcggccctttttagaaatttc
ctccttagcgaacggatcatgcgcacatacaagtgccatccaatatcgtcacctgaactg
ccagagacacaccatcatcctctgtggaaaagctgggatctagccgttgaaatggttttg
gctcagcttcctgcgctcattgatcatgaagaaggtcgtagacaatatgaataccaacac
tctacctttttcgctgagcagcttactgcttttgaggtgtacttgtcatctggacccaca
gagaaaaccccgccggatcagctacctattgtcctgcaagtccttttgagtcaggctcac
cgattgagggccctgattttactcagtaagttcctggacttgggaccctgggccgtccat
ctggctttgagcataggtatcttcccttacgtcgtcaagctcctacagtcggcagctcag
gagctgaagcctgttatggttttcatatgggcaagaatcatggcggtggaccatacagtc
cagaatgatctgctgaaggacaacggaatccactacttcatttctattctcaacccgtca
tcacccatacccgtcggaaacgctagcgaacatcgggccatgtgtgcattcattgtgtcg
atattttgcaaaaattatccccaaggccagaatgtgtgtctctcagcagaactctttgac
tcttgcttgaggcatctgatggatgttgagaatcctttactgcgccaatggtcatgtctt
tgcattagcatgctttggtctgatttccctgaggcaaagtggatggggattcgatgcgcg
gcacctgcaagactctgcgagctcaattttgatcctgtcccggaggtccgagccgcaatg
ttacatgccgtgacgacattcttgggtattcccgatttgacagatcaagtggcacagatc
gaagaatccttagccatggccgtgttaccaatggcatccgatggtagtgtacttgttcga
aaagaacttctggtattcttctcgactttcgtgagacgctatcaaaacaagttcctagtt
gccgcatatgacgagcttcaggatgagaagcagagccttctctccaaagtcgagcaagcg
acacctagaggtcattcctttgaggatgcaccgaatggctccgcaaatggctcgctttcg
agctacaagacacagaagctctctcgtaattctacttttggcactatttggaaacagctc
cttatcctgtctgttgacccacatcctgacatcgcacaggatgcagctacaattgttgat
tacattcatttgtcccttgtgcaatcccccatggcatcgctaactgaaaaaattcgtcaa
gaaataatggacctctcaaacagcttgtcacagaagacgcagatccgggaaagactagag
tcgaagaagactgcaccaccgccggctcctccgtcggttgctccaccaaaacaggaaggc
tatctttctctgagtttaaagcggactgctagtgtcgcggcgtccctaaaaaaccttgcc
tttggaggttcattaacagagccgcaatcgccgcaactttcagcctctgataagagtcgc
atgcccatgacgccacgaggacgagcccctccggaatggacccggccccccgaagtgaac
gaccaagttgcccctgcgacagcctaccaccaagctccaaccccaacatcccgcggcttc
gaacccaaggcatcatcaacccccccgaccgtccccttgatgagcaggttcctagactgg
tccacagagtatttccgggagccccagatgaaacccaatgagcccgatgaacccggtagc
gcggactacaacgaacgcctttggagaagaagccgtaacgaaaggatcatcacagagacg
cagcccctcaagagtaaagctggcagcagccgatgggatacttcaatagccctactctct
aacagcagccagcccatgaagatgtgctttcaccagttcgaggatcatatcgccgttgcg
gatgacaaagatactattgcgatctgggactggcaaagccacaaacgtctcaatcggttt
tctaacggaaatccaccagggtcaaagatcaacgaagtccgttacattaacgaagatgat
caagcacttttattgacaggttcttctgatggagttttgaagattttcaggaattacgag
tcctcacgggatgtcgagatcgtgacggcttttagagctctgccagagcttattcctagt
aaccgaaacgctgggcttgttctcgactggcaacagggccagggtaaggcgctagtcgca
ggagatgtgaaagtcatacgagtatggaatgctgcaactgaagtttgcaccaatgacatc
cctgctcgctcaggatcgtgcatcacttccctaacttccgatcaagttgcgggtaacatc
ttcgtagctggattcggtgatggggcagtcagagtattcgatcaacgcatcaagcccacg
acttccatggtcaaagtatggcgcgagcacaaacagtggattaccaatgtccacatgcaa
cggggtggcctaagagagctggtgtctggtagtcggaacggtgagattcgactttgggat
cttcggatggataatccaatttcgacgctgtacgccactaaagataccttgcgaacgttg
agcgttcatgaacacgctccagtattcatggtcggcaccaaccgccatgaagtcaagaca
ttcaacgttgacggcacctttctgtcgacgttcgagccttactcgagtttcctccatcac
aaccgctcttctccgatcgcaagcaccgcattccatcctcaccgcacggttctcgcctgt
gctgctcttaatgataatcatatcaatctggtttcctgctag

DBGET integrated database retrieval system