KEGG   Aspergillus oryzae: AOR_1_1078184Help
Entry
AOR_1_1078184     CDS       T01018                                 

Gene name
AO090009000643
Definition
elongator complex protein 3
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
aor  Aspergillus oryzae
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 575 aa AA seqDB search
MATATMTMPPPSKSKTNAKLPPENERYMRACSDIANVLIREYEAETDPKKPKKDLNLNRL
RNQIAKKHSLAHLPPLTAIIAAVPEHYKKYILPKLIAKPIRTSSGIAVVAVMSKPHRCPH
IAYTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFEQARGRVDQIKSLGHS
VDKVEYIIMGGTFMSLPEDYRESFIAQLHNALSGYQTDNVDEAVQAGEMSNVKCVGITIE
TRPDYCLDTHLSSMLRYGCTRLEIGVQSLYEDVARDTNRGHTVAAVAETFKLAKDAGFKV
VSHMMPDLPNVGMERDLFQFQEYFENPAFRTDGLKIYPTLVIRGTGLYELWRTGRYKNYT
PNALVDLVARILALVPPWTRIYRVQRDIPMPLVTSGVENGNLRELALARMKDFGTTCRDV
RTREVGINEVKNKIRPSQVELIRRDYTANGGWETFLAYEDPKQDILIGLLRLRKCSPTHT
FRPEFTGQQTSIVRELHVYGSAVPLHGRDPRKFQHRGFGTLLMEEAERIAREEHGSQKIS
VISGVGVRSYYARLGYTLDGPYMSKMLDPIEDEEL
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atggcgacggccacaatgactatgccgccaccctccaaatctaagacaaacgcaaagctt
cctccagagaatgaacgttacatgcgagcttgctctgatattgctaacgtccttattcga
gaatatgaagctgaaacggatcccaaaaagccaaagaaagatcttaatctgaacagactg
cgcaaccaaatcgcgaaaaagcacagtttggcccatctgccgcccttgacggccattatt
gctgctgtcccggaacattacaagaaatacatccttcccaaactaatcgctaagccgatt
agaacgtcttcgggtatcgccgttgtagccgtgatgagcaaaccccaccgttgtcctcat
atcgcatacaccggtaatatttgcgtctactgccctggtggacccgactccgatttcgag
tactcaactcagtcctataccgggtatgagcccacgtcgatgcgtgctatcagagcacgt
tatgacccgttcgagcaagccagaggacgtgtggatcaaattaaatctcttggtcacagt
gtcgacaaagtagaatatattattatgggtggaacgttcatgtctctacccgaggattat
cgcgaatcgttcatcgcccagctccacaatgcgttgagtggatatcagaccgacaacgtc
gacgaagccgtccaggccggtgagatgagcaatgtgaagtgtgttggtattacgattgag
actcggcctgactattgcctggatacacatttgagcagcatgcttaggtatggatgtaca
cgattggagattggcgtgcaaagtttgtacgaagatgttgccagagacacaaatcgaggc
cacaccgttgctgcagttgcagaaaccttcaagcttgcaaaggatgccgggtttaaggtg
gtcagccacatgatgcccgacttgccgaacgttgggatggaacgtgacctattccaattc
caggaatacttcgagaaccctgcttttcgaaccgacggtctcaaaatatacccaacttta
gtgatccgaggcactggcctctatgaactatggaggactggtcgttataagaactatact
cccaatgccttggttgaccttgtggctcgtattcttgccctagtccctccttggacccgt
atctaccgtgtccaacgagatattccgatgccgctggttacttcaggtgtagagaatggc
aacctgcgtgaacttgctttagccaggatgaaggactttggcaccacatgtcgggacgtc
cgtacccgtgaagtcggcattaatgaagtcaagaacaagattcgtccatcccaggtcgaa
cttattcgacgcgactacacagccaatggaggttgggagaccttccttgcctacgaggat
cccaagcaagacattctaatcggcttgttgcggttgcgaaagtgcagccctacacacact
tttcgccctgaatttactggccaacaaaccagtatcgtccgtgagctccacgtgtatggc
tctgctgtgccgttgcatgggcgtgatccacgcaagttccagcaccgtggttttggtact
ttgttgatggaggaagcagaacgcatcgcgcgggaggaacacggaagccagaaaatcagt
gtcatctctggtgtgggcgtgcgtagttattacgcgcgtctaggctataccttggatggc
ccttatatgtccaagatgttggaccctatcgaggatgaagagctataa

DBGET integrated database retrieval system