KEGG   Aspergillus oryzae: AOR_1_1118054Help
Entry
AOR_1_1118054     CDS       T01018                                 

Gene name
AO090011000651
Definition
folic acid synthesis protein
Orthology
K13941  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:2.7.6.3 2.5.1.15]
Organism
aor  Aspergillus oryzae
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aor00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AOR_1_1118054 (AO090011000651)
Enzymes [BR:aor01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     AOR_1_1118054 (AO090011000651)
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     AOR_1_1118054 (AO090011000651)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 464 aa AA seqDB search
MNPCNPPLHRAFIALGSNVGERVEMIEKACTEMERANIRVKRTSSLFETAPMYVLDQDPF
MNGVCEVETSLGPLELLDTIQSIEIGLGRKKLIDKGPRSIDLDILLYDEQIFSHDRLNIP
HQLMLERDFVLRPLCQLIPHERPPFPGHSTTYLSHLKSLPPPEPTPHATTYISKNFPPLH
STNPNRPTHIMAILNLTPDSFSDGGKHSPTDLTTLTNTVRTFIASGATIIDIGGESTRPG
SAPVGEAEELARVIPAIRHIRTSIPEAANIAISIDTYRARVAEEACAAGADIINDVSAGL
LDPNMLPTMARTGKAVILMHMRGTPSTMTQLTDYPNGVIEDVSAELLERISAAEAAGIRR
WRMILDPGLGFAKNQPHDLTILRDLQKFRTGVQGLEYFPWLMGPSRKRFIGRLTGVEKAS
ERNWGTAATVTASVAGGADIVRVHDVKEMWQVAKVADAIYRVDE
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgaatccctgtaaccctccgcttcaccgggcttttatagccctcggaagcaatgtcgga
gaacgggttgagatgattgagaaggcatgcaccgaaatggagagagccaatatcagagtc
aagcggacaagttccctgttcgagaccgctccaatgtacgtcctcgatcaagacccgttc
atgaatggggtttgcgaggtggaaaccagcttaggacctctggaactactcgataccatc
caatcgattgagatcggactgggaaggaagaagctgatcgacaagggaccccggtccatt
gatcttgatatcctgctctacgatgaacagatcttctcccacgaccgcctcaacatcccc
caccagctaatgctcgaacgggacttcgtactacgacctctctgccagctcatccctcac
gaacgacccccattcccaggtcacagcacaacctacctctcccatctcaaatccctcccc
ccgccagaaccaaccccccatgccacaacctacatatccaagaacttccctcccctccac
tccaccaaccccaaccgcccaacccacataatggccatcctaaacctaaccccggactcc
ttctccgacggcggcaaacactccccaacagacctaacaaccctaaccaacactgtccgc
accttcatcgcctccggcgcaacaatcatcgacatcggcggcgaaagcacccgtccaggc
tccgctcctgtcggcgaagccgaagaactagcccgcgtcatcccagcaatccgacacatc
cgcacatccatccccgaagccgcaaacatcgccatcagcatcgacacctaccgcgcccgc
gtcgccgaggaagcctgcgccgccggcgcagacatcatcaacgacgtctccgccggcctc
ctcgacccaaacatgctcccgacaatggcccgcaccggcaaagccgtcatcctcatgcac
atgcgcggaaccccatcaacaatgacccagctaacagactaccccaacggcgtgatcgag
gacgtgagcgccgagctcctcgagcgcatctccgccgccgaagcagccggtatccgccgt
tggcggatgatcctcgaccccgggcttgggttcgcgaagaatcagccgcacgatctgact
attcttcgtgatttacagaagttccgtaccggtgtccagggactagagtattttccttgg
ttgatggggcctagtcggaagaggttcattgggagacttactggtgttgagaaggctagt
gagcggaattggggcacggctgccactgttacggctagtgttgctggtggggcggatatt
gttcgtgtccatgatgttaaggagatgtggcaggtagccaaggttgcggatgctatttac
agggtggatgagtag

DBGET integrated database retrieval system