KEGG   Aspergillus oryzae: AOR_1_1128144Help
Entry
AOR_1_1128144     CDS       T01018                                 

Gene name
AO090023000654
Definition
cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
aor  Aspergillus oryzae
Brite
Enzymes [BR:aor01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     AOR_1_1128144 (AO090023000654)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 362 aa AA seqDB search
MASAARTASRAFLRSTPSVRPAVRSTRFALPTQAFRASARRGYASEAGEAKSSNTFLWAG
LAVAGGAGAYFYLQGGDSVSSKNFVPTKEDYQKVYDEIARRLADETDYDDGSYGPVLVRL
AWHASGTYDKETGTGGSNGATMRFAPESDHGANAGLKAARDFLEPVKAKFPWITYSDLWT
LAGSCAIQELGGPAIPWRPGRQDKDVAACTPDGRLPDASKDHQHVRDIFYRMGFNDQEIV
ALVGAHALGRAHPDRSGFDGPWNFSPTVFTNEFFRLLIDEKWQPRKWNGPAQFTDKTTGT
LMMLPADMAFVKDKAFKKHVERYARDSDAFFKDFADVYVKLLELGVPFESKPEDRIVFKT
SQ
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atggcctcagctgcgagaaccgcttcccgggccttcctccgctcgactccttccgtcaga
cctgcggtccgcagcactcgtttcgctcttcccacccaggccttccgtgcttcggctcgt
cgcggttacgcttccgaggctggtgaggccaagtccagcaacactttcctctgggctggt
ctcgctgttgccggtggtgctggtgcatacttctacctgcagggcggcgattccgtcagc
tccaagaacttcgtccccaccaaggaggactaccagaaggtgtacgacgagattgctcgt
cgcctcgccgatgagactgactatgatgacggcagctatggaccggtcctcgtccgtctg
gcatggcacgcaagtggcacctatgacaaggagactggtaccggaggtagcaacggtgcc
accatgagattcgcccctgagtccgaccacggcgccaacgctggtctcaaggctgccaga
gacttcctggagcctgtcaaggccaagttcccttggatcacctactccgatctctggact
ctggctggttcctgcgccatccaggagctgggtggccctgccatcccctggagacccggc
cgccaggacaaggacgtcgctgcctgcacccctgacggccgtctgcccgacgcctccaag
gaccaccagcacgtccgtgacatcttctaccgcatgggattcaacgaccaggagattgtg
gctctggtcggcgcccacgccctcggtcgtgcccatcctgaccgctccggtttcgatggt
ccctggaacttcagccctactgtcttcaccaacgagttcttccgtctgctgatcgatgag
aagtggcagcccagaaagtggaacggccctgcccagttcaccgataagaccaccggaacc
ctgatgatgctccccgccgacatggccttcgtcaaggacaaggcgttcaagaagcacgtt
gagcgctacgcccgcgacagtgatgccttcttcaaggacttcgccgatgtctacgtcaag
ctcctcgagctcggcgttcccttcgagagcaagcccgaggatcgcatcgtcttcaagacc
tctcagtaa

DBGET integrated database retrieval system