KEGG   Aspergillus oryzae: AOR_1_1136164Help
Entry
AOR_1_1136164     CDS       T01018                                 

Gene name
AO090001000630
Definition
cytochrome B5
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
aor  Aspergillus oryzae
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:aor00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 474 aa AA seqDB search
MPSFTLEQVQKHCKPDDVWFVLHNKVYDVTKYLEDHPGGNAILLEVAGTDATEAFEEVGH
SDEAREQLEPFYVGDLPTEEHTESVEIYRPTYEQVSQSAAVNVKTSTSWSSIIQTIIKCA
MTGLAGKSAITVYRRGITTTEIAHALRSLTTSISPRQGPGHDGSHFWAGVGIASAVQFSL
TLGLGMWISTKLDVQQEFTHHVPRRPAKPARMIRLSRTNIPIKKPSVLDPRKWRSFTLTS
KTEVAPHVYRFIFALPNPDDVLGLPTGQHIALRATINGQSVSRSYTPVSNNSDLGRIELL
IKVYPEGAMTQHLEQMKVGDSIEIRGPKGAMQYSRQYAKHIGMIAGGTGITPMYQLIRAI
CEDDSDKTQVSLLYANNTEEDILLRTELDNFARCHPEKFQVQYVLSHPGETWQGYQGFVN
GDLIAKHLAPAALENKVLLCGPPPMVAAMKKTLQGMGWTIPGAVAKAGDQVFLF
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgccgtccttcacccttgaacaggtccaaaaacactgcaaaccggacgatgtctggttt
gtcctccacaacaaggtctacgatgtgaccaaatatcttgaggatcaccccggtgggaat
gccattcttcttgaggtcgctggcaccgatgctacagaagctttcgaggaagtcggacac
tctgacgaagcccgggaacagttagagcctttctacgtaggcgacttaccgacagaggaa
catactgaatctgtcgagatctaccgcccaacctacgaacaagtctcacaatctgcggct
gtcaacgtcaaaacctccacctcctggtcatccataatccaaacaatcataaaatgcgcc
atgaccggtctagcaggcaaatccgccataacagtctaccgccgtggcataaccaccacc
gagatagctcacgctctgcgctccctcaccacatccatctctccccgccagggcccgggc
cacgacggatcccatttctgggccggcgtaggcatcgccagtgcagtccagttctcccta
accctgggcctgggaatgtggatttcgaccaagctagacgtgcagcaagaattcacccat
cacgttccccgtcggccagccaaaccagcacgtatgatccgactctcccggaccaatatt
ccaatcaagaaaccgagtgtcttggatccgcgcaaatggcgatcattcaccttgaccagc
aaaactgaagtcgcaccacatgtatatcgattcatctttgcgctgccaaatccggatgat
gtcctcggcctaccgacgggccaacacattgctctacgagcaacgatcaacggacaaagc
gtctcgagatcgtacacaccggtatccaacaacagcgacctaggtcgcatcgagctactc
atcaaagtataccccgaaggagcgatgacccagcatttagagcagatgaaagtaggcgac
tcaatcgagatccgcgggcccaagggcgcaatgcaatattcccggcaatatgcgaagcac
atcgggatgatcgcaggtggaacaggaattacaccaatgtaccagctcattcgggcaatc
tgcgaagatgacagcgacaagacgcaggtgtcactgctgtacgcgaataacacggaagag
gacattctgctgcgcacggagctagataacttcgcgaggtgtcatcctgaaaaattccag
gtgcagtatgtgctgagccaccccggggagacgtggcagggttatcaggggtttgtgaat
ggggatcttattgcgaagcatttggcgcctgctgcgctggagaataaagtgttgctgtgc
gggccgccgccgatggtggcggcgatgaagaagaccctgcaagggatgggatggacgata
cctggggctgttgctaaggctggggatcaggttttcttgttttag

DBGET integrated database retrieval system