KEGG   Aspergillus oryzae: AOR_1_1144024Help
Entry
AOR_1_1144024     CDS       T01018                                 

Gene name
AO090010000684
Definition
alpha-galactosidase C
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
aor  Aspergillus oryzae
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Brite
KEGG Orthology (KO) [BR:aor00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    AOR_1_1144024 (AO090010000684)
  Lipid metabolism
   00561 Glycerolipid metabolism
    AOR_1_1144024 (AO090010000684)
   00600 Sphingolipid metabolism
    AOR_1_1144024 (AO090010000684)
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo series
    AOR_1_1144024 (AO090010000684)
Enzymes [BR:aor01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     AOR_1_1144024 (AO090010000684)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 726 aa AA seqDB search
MAQETSSNNAVVADGKTFALNGENVSYRFRVNETTGDLVSDHFGGSITGNLFPGFGAEAL
GGWVGLAGRFRREFPDHGRGDFRIPAVRIRQEAGYTVTDLQYQSYSVIPGKPALPGLPST
FGSEEDVTTLVVHLYDNYSSIAVDLSYSIFPKYDAIVRSANVTNKGTQNITVEALSSFSF
DFPYEDLEMISLRGDWAREAHRQRRKVEYGLQGFGSSTGFSSHLHNPFLAIVHPSTTESQ
GEAWGFNLVYTGSFSVDVEKGSQGLTRALLGFNPSQLSWQLGAGETLTSPECVSVYSSDG
IGGMSRSFHRLYRNHLIKSKFATSDRPPLLNSWEGLYFDYNESTIYRLAEESAALGVKLF
VMDDGWFGDKYPRVSDNAGLGDWVPNPDRFPDGLTPLVEDVTKLKAGNSSTDLRFGLWVE
PEMANPNSTLYHEHPDWVLHAGQYPRTLQRNQLVLNLALPEVQDYIIDEITNILNSSAIS
YVKWDFNRAMHETPSPSNDHEYILGMYRVFDTLTTRFPDVLWEGCASGGGRFDPGVLEYF
PQIWTSDNTDALMRITIQLGTSLAYPPSAMGAHLSAVPNAQTGRTIPVKFRGHVAMMGGS
FGLELDPAELQEDEKAEVPGLIALAEKVNPIILTGDMWRLRLPEESNWPAVLFISEDGNQ
AVLFYFQLGPNVNHATPWLRLQGLDPKATYSVDGNGSYSGATLMNMGLQYKFESDYDSKV
VFLQKQ
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaggaaacttcaagcaacaatgcagttgtcgcggacggcaaaacatttgctctc
aatggagagaatgtctcataccgcttccgagtgaacgagaccacgggtgacctagtgtca
gatcatttcggcggcagtatcactggcaatctcttcccaggatttggtgccgaggcactt
ggcggctgggttggtttggcaggccgttttcgccgtgagtttccagatcacggccgggga
gattttcggattcccgccgttcggattcgtcaagaggcaggctacaccgtgacggatctg
cagtatcagtcatactcggtgattccgggaaagcctgctttgcccggtctgccttcaacc
tttggcagtgaagaggatgtcacaactttggtggttcatctgtacgacaactacagctcc
atcgctgtggatctgtcgtactcaatcttccctaaatatgacgccattgtgcgcagcgcg
aacgttacgaacaagggtactcaaaatatcacagttgaggcactgtccagcttcagcttc
gatttcccatacgaagatcttgaaatgattagcctcaggggcgactgggcgagagaagcc
caccgtcagaggcgaaaggtggaatacggactccaaggcttcggaagtagcactggtttc
tcctctcacctgcacaacccctttcttgcgatagtgcatccctccactacggaatctcag
ggtgaggcctggggatttaaccttgtctacacaggctcgttctccgttgatgtcgagaag
ggctcccagggcctcactcgcgctctgctgggattcaatcccagtcagctgtcttggcag
ctgggtgcgggcgagacacttacctcgccggaatgtgtttcagtctactcaagtgacggc
atcggcggcatgtctcgttcattccatcgcctctaccgcaaccacctgatcaagagcaag
ttcgccacatcggatcgcccgccgctgctgaacagctgggagggtctgtatttcgactac
aatgagagcacaatctaccgcttggctgaggagtcggccgccttgggagtgaaactgttc
gttatggacgacggttggttcggcgacaagtacccccgtgtatcggataacgccggtctg
ggtgactgggtgcctaacccggaccgctttcctgatggcctaacccccctggtggaagat
gtcacgaagctgaaggcaggaaactcctcaaccgacctccgctttggcctctgggttgaa
ccagaaatggccaaccccaactcgaccctgtaccatgagcaccctgactgggtgcttcat
gccggccaatacccacgcaccttgcaacgcaaccagctcgtgctcaaccttgctttgcct
gaggtgcaggactatatcatcgatgagattaccaacatcctcaacagctcggctatttcc
tatgtgaagtgggacttcaaccgggcgatgcacgagacaccctcccccagcaacgaccac
gaatacatcctgggcatgtaccgggtgttcgacaccctgaccacgcgcttccccgatgtt
ctgtgggaaggttgtgcctctggtggtggacgtttcgaccccggtgtacttgagtacttc
ccgcagatctggacctccgacaacaccgatgccctgatgcgcatcaccatccagctaggt
acttcactggcataccctccgagcgccatgggtgcccatctctcagcagtcccgaatgcc
cagactggacgtaccattcctgtcaaattccgtggccacgtcgccatgatgggcggatca
ttcggtctcgaactagaccccgccgagctgcaggaggatgagaaggccgaagtcccggga
ctgattgcccttgcagaaaaggttaacccgatcatcctgactggcgatatgtggcgtctc
aggcttcccgaggagtctaactggccggcggtgctattcatctctgaggatggtaaccaa
gctgtcctcttctacttccagctcggccctaatgttaaccatgccactccctggctcagg
ctgcagggattggatcctaaggccacgtatagcgttgatggaaacggatcgtactctggt
gcgacattgatgaacatgggactgcagtacaagtttgaatcggattatgatagcaaggtg
gtgttcttgcagaagcagtga

DBGET integrated database retrieval system