KEGG   Aspergillus oryzae: AOR_1_1152144Help
Entry
AOR_1_1152144     CDS       T01018                                 

Gene name
AO090023000671
Definition
aldose 1-epimerase
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
aor  Aspergillus oryzae
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aor00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AOR_1_1152144 (AO090023000671)
Enzymes [BR:aor01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     AOR_1_1152144 (AO090023000671)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 319 aa AA seqDB search
MDRSNKPSAIGVGASVPQPTISLRDNTVEATLPSGESVTIHLYGATVTSWKLANGKEQLF
VSEKAHLDGSKPIRGGIPVVFPVFGPPPQNHATSSLPQHGFARNSTWEFLGKSSSESLGK
DRSGDGSVKLDFGLSRPMLTEYFQKAWPYDFGLVYSVTLTKESLETSLQVQNKGSQNFDF
QVLMHTYLKIDDISDIRVKNLESKTYADKTQNAAVITETSPAVEINKETDRVYQSLDPKV
PIIVSSASDDKPIFSITREGLNDVVVWNPWIEKAKGMADFGPDEAYKNMICVEAGSVAGW
QTLEAGDFWEGGQSIRPRL
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atggaccgttctaacaagccttcggccatcggcgtgggtgcatctgtgcctcagcccact
atctccctccgcgataatactgtcgaagccacgctgccctccggcgaatctgttacgatc
cacctgtacggagctactgtcacttcctggaaattagcaaatggcaaagagcaattattt
gtgagcgagaaggctcatcttgacggttcaaagccaatccgcggcggtatccccgttgtg
ttccctgtcttcggtcctcctcctcagaaccatgccacctcctcccttccacaacacggc
tttgcgcgtaacagtacttgggaattcttgggcaagtcatcatcggaatccctaggcaag
gatcgcagcggagatggctctgtcaagctggacttcggtctctcccgccccatgctcaca
gaatatttccagaaggcatggccgtacgacttcgggctggtatatagcgttactttgacc
aaggagagtctggagacgtctctccaggtgcagaacaagggtagtcagaattttgacttc
caggtattgatgcatacgtatctcaagatcgacgacatctccgatatccgcgtcaagaac
ctcgaatctaagacctacgccgataaaacacagaatgctgccgtcatcaccgaaacctcc
cctgccgttgagatcaacaaggaaaccgaccgcgtgtaccaatcattggaccccaaggtg
cctattattgtttcgtccgctagtgatgataagcccattttctccattaccagggaggga
ctgaatgacgtcgttgtgtggaacccgtggattgaaaaggccaagggcatggctgacttt
ggtccggatgaggcatacaagaacatgatctgtgttgaagcaggctccgtggctggatgg
cagactttggaggccggtgacttctgggaaggcggacagtccatccggccgagactgtga

DBGET integrated database retrieval system