KEGG   Aspergillus oryzae: AOR_1_1198164Help
Entry
AOR_1_1198164     CDS       T01018                                 

Gene name
AO090001000664
Definition
histone acetyltransferase ESA1
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
aor  Aspergillus oryzae
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 506 aa AA seqDB search
MGVRDSHGEATATPDPVEKGFATLNTIRIGVKAMVQKDGELRKAEILSIRQRKDGPSFYV
HYVDFNKRLDEWIDSTRIDLSHEVEWPQPEKPEKKKAGPGNKAPSKNAQKRARAGSREVS
ATPDLLTGKNTNIGKAQRPSKAGGKENRDETPANLSVLDSEAISADVTPKPEMEDVDMIG
VSFTDTKEEHEQGKMSREEEIERLRTSGSMTQNPTEIHRVRNLNRLQMGKFDIEPWYFSP
YPASFSDVDMVYIDEFCLSYFDNKRAFERHRSKCTLVHPPGNEIYRDDRISFFEVDGRRQ
RTWCRNLCLLSKLFLDHKTLYYDVDPFLFYCMATRDETGCHLVGYFSKEKDSAEGYNLAC
ILTLPQYQRLGYGRLLIAFSYELSKREGKLGSPEKPLSDLGLLSYRQYWRETLVELLIEP
GRESMSENELAVLTSMTEKDVHETLVVFNMLRYHKGNWVIVLTDQVVEQHNKRLEKEKIK
GSRKIDPARLQWKPPVFTASSRTWNW
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgggcgtcagagattcccatggggaggcaaccgcgacgccggaccccgttgagaagggg
ttcgccaccctcaacaccattcgaatcggtgttaaggccatggttcagaaggatggagaa
ttgagaaaagctgaaattttgtctatcagacagcgcaaagatggtccaagcttttacgtc
cattatgtcgatttcaataaacgtctcgacgagtggatcgattccacaaggattgattta
tctcacgaggttgaatggccgcagcctgaaaaaccagagaagaagaaagcaggtcctggt
aataaagcaccgagcaagaatgctcagaagcgtgcaagagccggaagccgcgaggtttcg
gcaaccccagatctcttgacaggcaaaaacaccaatattggcaaagcacagcgtccgtct
aaggcaggcgggaaagagaaccgtgacgagacgcctgcaaatttgtcagttctagattcg
gaagccatttctgcagacgtgacccctaagcctgaaatggaagatgttgatatgatcggc
gtcagtttcacggataccaaggaagagcatgaacaaggtaaaatgtcacgcgaagaggaa
atcgaacgattgcgtacaagcggaagtatgacccaaaatcccacggaaattcaccgtgtg
cgtaacttgaatcgtctacaaatgggcaagtttgacattgagccgtggtacttctctcct
tatcctgcctcgttctcggatgtcgatatggtctacattgatgaattctgcttgagttat
ttcgacaacaaacgcgctttcgagcgtcaccgttcgaaatgtacacttgttcacccacct
gggaacgagatctatcgtgatgaccgtatatcattctttgaagtggacggtcggcgccag
cgcacctggtgccgcaatctttgccttcttagcaaactctttcttgaccataaaacactc
tactacgacgtcgaccctttccttttctactgcatggccactcgggatgagaccggttgc
catctggtgggctatttctccaaagaaaaagattccgcagaaggttataaccttgcttgt
atcttgaccttaccacaataccagcgtctcggctacgggcgactgcttattgctttcagc
tatgagctcagcaagcgagaaggaaagcttggctctccagaaaagcccctcagtgacctg
ggtctgctaagttatcggcaatactggcgagaaacactcgtggagttactcatagagccg
ggccgagagtccatgagtgagaacgaacttgctgtgttaacgtctatgaccgagaaggat
gtgcatgagacactggttgtgttcaatatgcttagataccacaaaggaaactgggttatc
gtcctcacggatcaagttgtggagcaacacaataagcgtcttgagaaagagaaaattaaa
gggtcgcgcaaaatcgaccctgcacgcttacaatggaagcctccagttttcacagcttca
agtcgaacatggaattggtga

DBGET integrated database retrieval system