KEGG   Aspergillus oryzae: AOR_1_1210164Help
Entry
AOR_1_1210164     CDS       T01018                                 

Gene name
AO090001000670
Definition
ubiquitin hydrolase L3
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
aor  Aspergillus oryzae
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 250 aa AA seqDB search
MTDHVDVPETNKAFVPLENNPEVMSHLVHQLGLPPSLGFTDVYSIDEPDLLAFVPRPSHA
LLLVFPVSKTYESSRISEDSKLTDYTGSGPSEPVMWFKQTIRNACGLIGLLHAVSNGEAR
KQVLPGSDLDGLLRDAEPLSPIDRANLLYESKALESAHADAAKLGDTTAPQAEDSVDLHF
VAFVKGVDGRLWELDGRRKGPLERGKLDEDEDALSEKALELGVRRFLKTEAQGGNPDLRF
SLVSLGPVFD
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgacagaccatgtcgatgtcccagaaaccaacaaggccttcgtgcccctcgaaaacaac
ccagaagtgatgtcgcacttagtccaccagctcggtctcccaccaagcctaggcttcaca
gacgtatactcaatcgacgagccagacctcctagccttcgtcccccgtccctcgcacgcc
cttctcctcgtcttccccgtctccaaaacctacgaatcgtcccgcatatccgaagacagc
aagctcaccgactatactggctcgggaccttcggaacccgtcatgtggttcaaacagacg
atccggaatgcttgcggtttgatcggattgttgcacgctgtgtccaatggagaggctcgg
aaacaggtccttcctggatcggatttggatgggcttttgcgggatgcggagccgcttagt
cctatcgacagagcgaatctactatatgagagcaaggcgctagagagtgctcatgctgat
gcggcgaagttaggtgatactacggcgccccaggcagaggattccgttgacttgcacttt
gttgcgtttgtgaagggggttgatggaaggttgtgggagctggatgggaggaggaagggt
ccgttggaaaggggaaagttggatgaggatgaggatgcattgagcgagaaggcgctcgag
ctgggagttaggaggttcttgaagactgaggctcagggtggtaacccggacttgaggttc
agtttggtcagtttggggcctgtttttgattaa

DBGET integrated database retrieval system