KEGG   Aspergillus oryzae: AOR_1_1216054Help
Entry
AOR_1_1216054     CDS       T01018                                 

Gene name
AO090011000715
Definition
endo-beta-1,4-glucanase A
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
aor  Aspergillus oryzae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aor00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AOR_1_1216054 (AO090011000715)
Enzymes [BR:aor01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     AOR_1_1216054 (AO090011000715)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 490 aa AA seqDB search
MRIGNLIVAASAASLVHAYPTRDIKKRGSGFTWVGVSESGAEFGSSIPGTLGTDYTWPDT
SKIQVLRDDGMNVFRIPFLMERLAPNQMTGSLDATYLKDLKSTVQAVTDSGAYVVLDPHN
YGRYSGSIISSTSDFKTFWKTVAGEFASNEKVIFDTNNEYHDMEQSLVLSLNQAAIDGIR
AAGATTQYIFVEGNSYSGAWKWADTNDNLSQLTDPQDKIVYEMHQYLDSDGSGTSETCAS
STIGKERLQTATEWLKTNNKKGFLGEFAGGVNEQCEQAVEGLLSYMSDNSDVWMGAEWWS
AGPWWGSYMYSMEPTDGTAYSTYLPILKKYFVDGAGASTSSSATSAAPSTAAASTSTSVS
ASTSSASSTTISAVESSSTSSVAEAPSTTSGVVTATPTPSHPAPQPTSNSSSASSGAPTS
SAPTTLATSPACGYQTTVTVTASRSTAAPSSSAGAVAHYYQCGGINYSGPTTCESGYTCV
KQNPYYSQCL
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgagaatcggcaacttgatcgtggctgcaagtgctgcaagcctggtgcatgcgtatccc
acgcgtgatatcaaaaagcgtggctcgggattcacctgggtcggcgttagcgaatctggc
gctgagttcggatccagcatcccaggaacactgggcaccgactacacttggcctgataca
tctaagattcaggttctgagggatgatggaatgaacgtcttccgtattcccttcctcatg
gagcgtttggcacccaaccagatgactggatctctggacgcgacctatttgaaggacctg
aaatctactgtccaagccgtcactgatagcggtgcttacgtcgttctcgacccccacaac
tacggacgatactctggaagtatcatttcttctacttctgactttaaaacattctggaag
accgtcgctggagaatttgcatcgaacgagaaggtcatcttcgatactaacaacgagtac
cacgatatggaacagtctctcgtccttagcctaaaccaggccgccattgacggcattcgc
gcggctggagccacgacccaatacatttttgttgagggcaattcgtactcgggtgcttgg
aagtgggccgataccaacgacaacctcagtcaattgactgacccgcaagacaagattgtc
tacgagatgcaccagtatctcgattcggatggctctggtacctccgagacctgtgccagc
tcaaccatcggcaaggagaggctgcagaccgccacggagtggttgaagaccaacaacaag
aagggtttcctgggtgaattcgccggcggtgtcaacgagcagtgcgagcaggctgtcgag
ggtctcctctcttacatgtcagacaactccgacgtctggatgggtgccgaatggtggtcg
gctggcccctggtggggttcctacatgtacagcatggagccgactgacggaactgcttac
tctacatacctccctatcctgaagaaatacttcgtggacggcgctggcgctagcaccagc
tcatcggccacttccgcagccccctcaactgcagctgccagcacctctacctctgtcagt
gcctcgacttcctctgcatcctcgactaccatcagtgctgtcgagtcctcctccactagt
agtgttgccgaagccccctcaaccacctcgggagttgtcactgccacgcctaccccatct
cacccagcccctcagccaacctccaactcgtccagcgcttcatcaggtgcgcccacaagc
agcgccccgacgactcttgcgacttccccggcctgtggataccaaaccactgtcactgtg
accgccagcagatcaaccgcagcacccagcagctccgcaggcgccgtcgcccactactac
cagtgcggtggaatcaactacagcggacccaccacctgcgagagcggctacacctgcgtc
aagcagaacccctactacagccagtgcctgtaa

DBGET integrated database retrieval system