KEGG   Aspergillus oryzae: AOR_1_1230154Help
Entry
AOR_1_1230154     CDS       T01018                                 

Gene name
AO090003000697
Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
aor  Aspergillus oryzae
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:aor00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AOR_1_1230154 (AO090003000697)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    AOR_1_1230154 (AO090003000697)
Enzymes [BR:aor01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     AOR_1_1230154 (AO090003000697)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 324 aa AA seqDB search
MTQPSTITQRFLSKPGNLGVVAVGFNGGQCKLGVEAAPMALVEAGLLDQLRDDLGYTLDY
DGTVHYYENQIPAEDPDHRGMKKPRAVSAVTEALSAQVYEKAKQGQMVLTLGGDHSIAIG
SISGSAKATRERLGRELAVIWVDAHADINIPEMSPSGNIHGMPMAFLTRLAREEQKDIFG
WLQDEHIVSTRKLVYIGLRDVDRGEKQILREHGIKAFSMHDIDRYGIGRVVEMALAHIGN
DTPIHLSFDVDALDPQWAPSTGTPVRGGLTLREGDFICECVHETGNLVAMDLVEVNPSLE
SVGASETIRTGCSLVRSALGDTLL
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgactcaaccctccaccatcacacaacgcttcctgtccaagcccggaaatctgggtgtg
gtagcagtcggcttcaatggcggccagtgcaaacttggagttgaggctgcccccatggcc
ctggtcgaggctggcctcctcgatcaactccgcgacgaccttggctacaccctcgactat
gacggcaccgtccactactacgaaaaccagatccccgccgaagatcccgaccaccgcggc
atgaagaagccgcgcgctgtgagcgccgtgaccgaagcgctgagcgcacaggtctacgag
aaagccaagcagggtcagatggtcttgacactgggaggtgatcactcgatcgccatcgga
tccatctccggctcggccaaggctacccgcgaacgcctgggtcgggagctggccgtcatc
tgggttgatgcgcacgccgatatcaacattccggagatgagccctagtggaaacatccac
ggtatgcccatggcgttcttgacgcgcttggcccgcgaggagcagaaggacatcttcggc
tggttgcaggatgagcacatcgtcagcacccgtaagctggtctacattggtctgcgcgat
gttgatcgcggcgagaagcaaatccttcgggagcatggcattaaggcgttcagcatgcac
gacattgaccggtacggtattggccgtgtggttgagatggctctggcccacatcggaaac
gatacccctattcacctttcattcgacgtcgatgctctggatccgcagtgggctcccagc
accggcactcccgtgcgtggcggtctgactcttcgtgagggtgatttcatctgcgagtgt
gtgcatgagacgggcaacctggtcgccatggacctggtggaggtcaaccccagcttggag
tcggtaggcgcctccgaaaccattcggaccggttgctcgttagtgcgcagtgcactgggt
gacaccctcctgtga

DBGET integrated database retrieval system