KEGG   Aspergillus oryzae: AOR_1_1242164Help
Entry
AOR_1_1242164     CDS       T01018                                 

Gene name
AO090001000694
Definition
agmatinase 2
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
aor  Aspergillus oryzae
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aor00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    AOR_1_1242164 (AO090001000694)
Enzymes [BR:aor01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     AOR_1_1242164 (AO090001000694)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 416 aa AA seqDB search
MKYTLGLLALAGTALSHAHHDDTEVVPEHLREELLKKWDQEWTFSGIASFAHLKPVKCLI
EPDERYDIAVIGAPFDTAVSYRPGARFGPRAIRAASARQMAGTAYNTRAGINPYSSWATV
KDCGDIPIIPFDNGVAERQMYEAFLELGSRSPITPADSKYGTKGISAGKAKLVTLGGDHS
VALPALRALYQIYQKPITVLHFDAHLDTWNPVRYSAYWTSEQSAFNHGSFFHKASREGLI
CNSTSAHAGLRTRLTGVTDSDYTNPGPEQGFMRIHADDIDDLGPMGIVDKIIERIGLDSE
QPVYLSVDIDVLDPATAPGTGTPEPGGWTTREFIRIMRGIEKLNIVGADIVEVSPSYDNK
GETTALAAAQVAFEIITSMVKAGAGEDLGGWYGRKEEKIDESAKEGEAKKEGKDEL
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgaaatataccctggggttgctggctctggccggtactgccttatctcacgcccatcac
gatgacacggaagtggttcctgagcacttgcgtgaggagctgttgaagaaatgggatcaa
gagtggacattttctggcattgctagctttgcgcacctaaaaccagtcaaatgtctaatc
gaaccagatgagcgatatgatatcgccgtcatcggagcccccttcgatactgctgtcagc
tacagaccaggagctcgttttggtcctcgtgccattcgtgctgctagcgcccgccagatg
gccggtacagcctataacacccgtgcgggcatcaatccctacagctcgtgggccaccgtc
aaggactgtggggatatccctataattcccttcgacaatggcgtagcggagcgccaaatg
tacgaagctttcctcgagctgggctcacgatctcccattacccctgccgactccaagtac
ggcactaagggcatctctgccgggaaggcgaagctggtcaccctgggaggtgatcacagt
gttgcgctaccggctctccgtgccctgtatcaaatctaccaaaagcccatcacagtactg
catttcgatgcacatctagacacctggaatcccgttcgctactcggcatactggacatca
gaacagtcggcgtttaatcacggcagtttcttccacaaggcgagtcgtgagggtctcatt
tgcaactcgacctctgctcatgctggtctgcgcactcgtttgactggtgtcaccgatagc
gactacaccaacccgggccccgagcagggattcatgcgcatccatgctgacgacattgac
gacctaggccccatgggcatcgtggataaaataattgagcgcatcggtctggattcggag
caacccgtgtatctgtcggtggacattgacgtgcttgaccccgcgactgcccccgggacc
ggtactcccgagcctggcggctggaccacccgtgagttcatccggatcatgcgcggcatt
gagaagttaaacattgtcggcgcggacatcgttgaggtatcgccaagttacgacaacaag
ggagagaccaccgctctcgcagctgcccaagtggcctttgagatcatcaccagcatggtc
aaggcgggagctggcgaagacctgggaggatggtatgggcgcaaggaagagaagatcgat
gagtctgcaaaggagggagaagcgaagaaagaaggcaaagacgagctgtaa

DBGET integrated database retrieval system