KEGG   Aspergillus oryzae: AOR_1_1258194Help
Entry
AOR_1_1258194     CDS       T01018                                 

Gene name
AO090012000721
Definition
palmitoyl-protein thioesterase precursor
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
aor  Aspergillus oryzae
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:aor00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    AOR_1_1258194 (AO090012000721)
  Lipid metabolism
   00062 Fatty acid elongation
    AOR_1_1258194 (AO090012000721)
Enzymes [BR:aor01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     AOR_1_1258194 (AO090012000721)
Lipid biosynthesis proteins [BR:aor01004]
 Fatty acid synthase
  Component type
   AOR_1_1258194 (AO090012000721)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 327 aa AA seqDB search
MRTLALLAIPFLSSAIPLHQPKTTESAPLPLVIWHGLGDDFQREGLLSVASLAEKTNPGT
YVHLIHLSDTASGDRQATFLGNVSEQIDTVCAQLASDRILSTAPAINALGFSQGGQFLRG
YIERCNVPPVHNLVTFGSQHNGIAEFQECGWGDWICRGAEALLRAGRWSPFVQGRFVPAQ
YFRDPTELDEYLASSNFLADVNNEREEKNETYRENLGCLNKFAMYMFEEDQMVHPKESAW
FGELDGETGDVIGVRERDIYREDWIGLKKLDEEGRLVFRSVPGKHMQLSEEVLVNVFGEF
FGPVEVDVDVEGEGEVRGKALVKQIGY
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaccctcgcgcttctagctatccctttcctttcaagtgccatccccctccaccag
cctaaaaccaccgaatccgcaccccttccactggttatctggcatggcctcggcgacgac
ttccaacgcgaaggcctcctctccgtcgcctccctcgccgagaaaaccaacccaggaacc
tatgttcaccttatccatctctcagacactgcctccggtgatcgtcaagccaccttcctc
ggcaacgtcagtgagcaaatcgacaccgtctgcgcccaactcgcctccgaccgcatcctc
agcacagccccagcaatcaacgccctcggattctcccaaggcggccagttcctccgtggc
tacatcgaacgctgcaacgtgccgcccgtccacaaccttgttaccttcggcagccagcat
aacggcattgccgaattccaagaatgcggctggggcgactggatctgccgcggtgccgag
gcgctcctccgggcaggacgttggtcgcccttcgtgcagggccggttcgttcctgcacag
tatttccgcgatccgaccgaactggacgagtacctggccagtagcaattttcttgccgat
gtgaataatgagcgtgaagagaagaatgagacataccgggagaatctggggtgcttgaat
aagtttgcgatgtatatgtttgaagaggatcagatggtgcatccgaaggaaagtgcgtgg
tttggggagctggatggggagacaggggatgttatcggcgtgagggagagggatatctat
agggaggattggattgggttaaagaagttggatgaggaggggagactggttttcaggtct
gttccggggaaacatatgcagttgagtgaagaggttctggttaatgtctttggggagttt
tttggtccggtggaggttgatgttgatgttgagggtgagggtgaggtgcggggaaaggct
ttggttaagcaaattgggtattga

  All links  
No link information was found.   
DBGET integrated database retrieval system